Разобрать слово большие по составу: 404 Не найдено

Содержание

Сотрудников МЧС с профессиональным праздником поздравил Владимир Путин

Сегодня мы поздравляем с профессиональным праздником людей, которые первыми оказываются там, где нужна помощь: пожары, наводнения, техногенные катастрофы. Они рискуют собой, спасая других. Сотрудников МЧС поздравил президент. Владимир Путин поблагодарил их за нелегкую напряженную службу: «По уровню профессионализма, накопленному опыту, по скорости и четкости отработки сложнейших экстраординарных задач наши спасатели среди лучших. Вы задаете стандарты, которые служат ориентиром для ваших коллег во всем мире. Россия по праву гордится вами. И наши граждане точно знают, что сотрудники МЧС готовы прийти на выручку в любое время дня и ночи. Что задействуют все резервы, все доступные силы и средства, технику, личный состав, чтобы в кратчайшие сроки ликвидировать любую угрозу. И будут бороться за каждого человека, даже ценой собственной жизни. Наши товарищи, которые, исполняя свой долг пожертвовали собой ради других, навечно останутся рядом с нами в почетных списках лучших бойцов МЧС. В их числе и мужественные бесстрашные горноспасатели, погибшие на шахте Листвяжная, и министр, генерал армии Евгений Николаевич Зиничев. Уверен, что российские спасатели всегда будут чтить, свято хранить и соблюдать традиции самоотверженного, преданного служению своей стране и народу».

И сегодня в День спасателя в Москве провели торжественную церемонию. Участие в ней приняли министр обороны Сергей Шойгу, который долгие годы руководил МЧС, и временно исполняющий обязанности главы МЧС сейчас Александр Чуприян. Они возложили цветы к памятнику спасателям и пожарным. Все, кто выполняет служебный долг, рискуя собой, – настоящие герои. От них зависят тысячи жизней.

– Уфа, 1991 год, над уфимским нефтеперерабатывающим заводом нависла угроза катастрофы.

Надломившийся 700-тонный кусок производственной трубы при падении мог вызвать ужасающие последствия для миллионного города. Эта операция стала одной из первых и для будущего МЧС России, тогда только созданного корпуса спасателей. И для Сергея Шойгу, руководившего ведомством почти двадцать лет.

– Спасатели выполнили необходимые расчеты, поднялись по накренившейся трубе и заложили более 400 килограммов взрывчатки.

Такого раньше не делал никто. Направленным взрывом обломки трубы точно обрушили на подготовленную площадку.

С тех пор уникальных операций российскими спасателями было проведено немало. Одна из таких разворачивалась в августе 2009 на Саяно-Шушенской ГЭС.

Иван Сулаев, начальник службы оперативного управления отряда Центроспас МЧС РФ: «Там просто были огромные, так скажем, разрушения, и сами конструкции, которые были разрушены, они были тоже огромные. И поэтому было непонятно изначально, как все это можно разобрать».

И, тем не менее, из затопленных смесью воды и едких технических жидкостей помещений удалось спасти двоих сотрудников станции.

Иван Сулаев, начальник службы оперативного управления отряда Центроспас МЧС РФ: «Туда попасть в принципе было невозможно в обычном костюме водолазном, просто потому, что его разъест. Сделали немножко по-другому. Пробились к ним через потолок и через часть стены и, собственно так их и вытащили».

Хотя первые часы считаются самыми ценными, поисковые операции никогда не прекращаются, пока есть шанс спасти хоть кого-то.

Спустя сутки после разрушения взрывом газа секции многоэтажки в Магнитогорске из под обломков извлекают десятимесячного малыша.

Петр Гриценко, в 2019 г. начальник управления первоочередных спасательных работ центра «Лидер»: «Когда увидел я его, что он розовый, что ручки, ножки у него, розовое, что личико, он дышит, смотрит, реагирует на нас. Когда передал его медикам, когда мы вышли с завалов, чувство гордости и радости неописуемой, что мы смогли спасти ребенка».

Ради этого и приходят в профессию. Ради этого постоянные тренировки. Не только на земле, но и в воздухе и под водой. Водолазы центра «Лидер», созданного для особо рискованных операций, учатся погружаться все глубже. В подразделениях постоянной боевой готовности все, что только может потребоваться, всегда быть под рукой.

Посмотрите, как все аккуратно разложено по полочкам. Гидравлический инструмент. Например, вот такие вот тяжеленные ножницы. Далее бензопилы, запас воздуха в баллонах. Пневмоподушки, которые используются как особенно мощный домкрат. А вот в этих ящиках все то же самое, только упаковано в зависимости от задач, будь то наводнение или землетрясение. В каждом набор инструментов на группировку из двадцати человек.

Каждое действие спасателя доведено до автоматизма. В структуре, в которой отточенная техника и холодный расчет сочетаются с отзывчивостью и чувством долга, Евгений Зиничев сразу стал своим. Все три года на посту руководителя МЧС он постоянно был в центре событий. С теми, кто спасал и теми, кому нужна была помощь. Профессиональный инстинкт, который заставляет сначала думать об окружающих. Когда рядом стоящий человек оступился и упал в пропасть, министр не раздумывая бросился за ним, пытаясь спасти. Гибель Евгения Зиничева стала личной утратой для Владимира Путина, с которым они долго вместе работали, и, конечно, для сотрудников МЧС.

Максим Комаров, заместитель начальника ГУ МЧС России по г. Москве: «Конечно, для каждого из нас это и личная утрата, и большое горе, потому что министра действительно мы воспринимали как настоящего командира, за которым шли, на которого равнялись».

Они все так или иначе рискуют жизнью. Многие даже сейчас, в свой профессиональный праздник. Борются с пожарами. Или вызволяют из снежного плена людей.

Александр Чуприян, врио министра РФ по чрезвычайным ситуациям: «Спасатели МЧС России всегда на передовой. Каждая чрезвычайная ситуация требует от вас предельной собранности, оперативности и умения принимать верные решения. Вы первыми оказываете помощь тем, кто попал в беду, рискуя своим здоровьем, а иногда и жизнью».

Но риск этот неразрывно связан со спасением. Именно поэтому оказаться в рядах спасателей сегодня считают за честь тысячи молодых людей.

обзор модели Aigo Eros H05 / Hi-Fi и цифровой звук / iXBT Live

Сегодня я хочу рассказать о довольно любопытном Hi-Fi аудиоплеере от в свое время нашумевшего бренда Aigo. Называется модель Eros H05 и, в отличии от всего остального, что сегодня нам предлагает данная компания, базируется она на полноценном выделенном чипе ESS ES9038Q2M, имеет 4-дюймовый IPS экран, батарею на 3000 мАч и до 450 мВт мощности на 32 ома нагрузки. И это на балансном 2.5 мм выходе. Также тут имеется поддержка как PCM, так и DSD форматов. В общем, заряжен аппарат реально по-взрослому, отчего при цене в 164 доллара вызывает просто адский интерес. Вот его мы сегодня подробно и рассмотрим.

Характеристики
  • Экран: 4.0″ IPS 480 x 800
  • ЦАП: ESS ES9038Q2M
  • Разрешение звука: до 192 кГц/24 бита, DSD128
  • Выходная мощность: 125/450 мВт на 32 Ома
  • Диапазон частот: 20 Гц – 40 кГц
  • Аккумулятор: 3000 мАч (до 10 часов работы)
  • Входы: Type C
  • Выходы: 3.5 мм. и балансный 2.5 мм.
  • Размеры: 119.5 x 67.5 x 18.5 мм
  • Вес: 205 г
Упаковка и комплектация

Пришел плеер в небольшой картонной коробке с изображением устройства и полным списком достоинств на обратной стороне.

В комплект нам положили небольшую, но очень подробную инструкцию на китайском языке и столь же короткий Type C кабель.

Дизайн/Эргономика

Выглядит аппарат, конечно, гораздо дороже 160 долларов. Вся передняя часть отдана под большой 4-дюймовый IPS дисплей с очень приличными углами обзора. Экран большой, яркий, но, к сожалению, не сенсорный. Для управления выделены пять сенсорных кнопок под ним: меню, возврат, вперед, назад и ок.

Нажатие любой из них вызывает сенсорный отклик, то есть внутри корпуса стоит вибромотор, как на смартфонах. В руку аппарат ложится уверенно, а на стекло с завода наклеена пленка. Которая за три-четыре месяца использования у меня покрылась мелкими царапинками. Поэтому я ее снял. Как в этом плане само стекло — пока еще не знаю.

Сзади у нас похоже, что тоже стекло и тоже было прикрыто защитной пленкой. Сюда нам нанесли какие-то иероглифы, абстрактный рисунок и адрес официального сайта компании.

Все же остальные части корпуса выполнены исключительно из металла. Что, как говорится, внушает уважение. Левую грань нам оставили без каких-либо функциональных элементов, зато на правую определили кнопку включения, постоянно горящий синим светодиод и три клавиши управления: вперед — пауза — назад, чтобы можно было управлять музыкой, не извлекая плеер из кармана. Да, как в старые добрые времена.

Снизу установлен Type C порт и слот для карт памяти. Проверял до 256 Гб включительно — все работает.

А сверху имеем горизонтальный регулятор уровня от компании Alps и два выхода на наушники: классический 3.5 и балансный на 2.5 мм. Ход у регулятора приятный, с легкими механическими щелчками. К управляющим элементам у меня вообще нет вопросов — все работает как часы. Громкости здесь тоже с огромным запасом. Только подумайте, 125 мВт на 3.5 мм выходе и 450 мВт на балансе. Этого вполне достаточно, чтобы раскачать большинство даже в очень тугих полноразмерных наушников. Слушал же я в среднем на 36 пунктах из 100 возможных. Сами понимаете размах. Ну и для удобства нам сделали два режима усиления — низкий и высокий.

Железо и особенности подключения

По железу аппарат может похвастаться фирменным преобразователем ESS ES9038Q2M, который реализует PCM до 24 бит 192 кГц и DSD128. Впрочем, при подключении к компьютеру в режиме USB DAC система показывает возможность воспроизведения до 24 бит 352.8 кГц. Что чуть выше заявленного.

Однако именно с режимом USB DAC я встретил первые странности. На официальном сайте можно найти соответствующий драйвер, который, к моему изумлению, не имеет подписи. Для того, чтобы установить его на Windows 10 нужно отключить в режиме безопасности этот самый режим. Следовательно, по факту мы имеем только автоматическое определение в Windows 10. Попытка отключить проверку подписи из реестра ни к чему не привела. В процессе установки я получаю ошибку.

Так что режим ЦАПа у плеера есть, доступен и прекрасно работает, но только через WASAPI.

Пробовал подключать аппарат к смартфону в виде внешнего ЦАП. Тот его определяет, но тут же теряет связь. Так что в виде звуковой карты использовать героя обзора можно только с компьютерами.

Использовать же Eros H05 в качестве цифрового источника вообще не получится. Такой функции он просто не поддерживает, как и всякие блютуз с Wi-Fi. Только файлы — только хардкор. Аккумулятора на 3000 мАч плееру хватает примерно на 10 часов активного использования. Для усилителя в пол ватта на канал — это вполне приличное значение.

Интерфейс

Интерфейс здесь вполне стандартный. В верхней строке находится активный уровень громкости, время и состояние аккумулятора. Основное же меню состоит из плейлистов, избранного, файловой медиатеки, настроек воспроизведения и системных настроек. Плейлистами и избранным я не особо пользуюсь, оттого захожу в файловый браузер и вперед.

Шрифты тут абсолютно нормальные, за исключением русского, который моноширийный. То есть между буквами имеется пространство. Картинки аппарат отображает, кнопка ок дублирует паузу, а сенсорные вперед назад повторяют физические кнопки перемотки. При нажатии включается следующая или предыдущая композиция, ну а если держим, то получается перемотка.

На экране нам отображается текущий формат и регулятор прогресса. При нажатии на кнопку меню можно поменять последовательность воспроизведения, добавить в избранное, добавить в плейлист, посмотреть информацию о файле или удалить композицию.

В настройках воспроизведения тоже можно поменять последовательность, переключить 3.5 мм выход с наушников на линейный, выбрать один из пресетов 10-полосного эквалайзера или накрутить свой, переключить режим работы усилителя, компенсацию громкости для DSD формата, настроить баланс, выбрать один из шести цифровых фильтров, установить максимум цифрового потока, громкость по умолчанию, гаплесс и что запоминать при выключении плеера: трек или место в нем. Как видите, только самые необходимые пункты.

В системных настройках можно выбрать язык, тип сканирования медиатеки, стиль заглавного экрана, шрифты, скрин сейвер, кнопку пробуждения, подсветку и ее время, различные таймеры, как будем подключаться по USB к компьютеру: в виде ЦАП или как флешка, обновление и сброс настроек до заводских.

CUE аппарат читает без проблем, Hi-Res и DSD — тоже. Только ISO у меня не распознал, а так все запустилось.

Измерения

Замеры на 24 бита 96 кГц и максимальной громкости показали все пункты в состоянии «отлично».

Ну разве что, кроме кривой АЧХ, имеющей вполне допустимые отклонение на 0.2 Дб на частоте 20 кГц.

В остальном же какой-то просто запредельный уровень шума, отличный динамический диапазон и все виды искажений ниже уровня минус 110 Дб, что для моего измерительного стенда практически предел.

То есть на самом деле все может оказаться даже еще лучше. И это все на максимальной громкости с обычного выхода 3.5 мм. С баланса, наверное, тут вообще что-то запредельное. Что сказать, технически очень грамотно выполненное устройство. Хотя другого от Aigo и не ожидалось, они уже лет 20 выпускают плееры, в том числе и аудиофилского уровня.

Звук

Для оценки звучания сначала грубо сравню его со всем, что у меня под рукой. В частности у меня еще есть прекрасный малютка HiBy R2 стоимостью чуть более сони долларов и тройка ЦАПов: Shanling UA1 Pro, Audirect Atom 2 и Shanling UP5. Для начала, у R2 против героя нашего обзора ну практически без шансов — уровень заметно ниже. Хотя то и понятно, там блютуз, Wi-Fi, сенсорный экран и до блеска вылизанный софт. Оттого разница, на мой взгляд, просто очевидна. Если же к R2 подсоединить UA1 Pro или Atom2, то уровни мгновенно сравняются. То есть суммарно R2 и какой-нибудь свисток в районе 60 долларов будут играть в уровень с Eros H05. А это очень высокая похвала, так как тот же смартфон с указанными ЦАПами делает покупку R2 сомнительной, а вот Eros уже так просто не обойти.

В сравнении же героя обзора против Shanling UP5 — у Aigo вообще не единого шанса. Да, H05 звучит чуть резче, техничнее и, я бы даже сказал, детальнее, но UP5 по балансу сильно превосходит естественностью, качеством проработки и глубиной музыкальных образов. Eros, конечно, хорошо играет, но он более нейтральный и прямой. Хотя в плане артикуляции вокала он, без сомнения, чуть впереди. Неплохо тут организована и прорисовка текстур, и общая динамика. Но данный факт касается больше балансного выхода, поскольку с 3.5 мм Aigo играет заметно мягче и теплее. А вот при переходе на 2.5 мм все атаки ускоряются, а само звучание получает хороший буст в детализацию, чистоту и техничность. Словно в оптике нам наконец навели резкость и легкий аналоговый туман переходит в четкие контуры музыкально полотна. Так что 3.5 мм разъем здесь, без сомнения, полезен, но музыку лучше слушать именно с балансного.

Низкие частоты тут глубокие и текстурные, середина обладает легким оттенком нейтральности, поскольку выразительность и передача эмоций — на просто превосходном уровне. Не много и не мало. Такой очень натуральный баланс. Поддержка всяких Hi-Res и DSD форматов здесь тоже присутствует не для галочки, Eros действительно умеет их неплохо так отыгрывать. Что для бюджетного сегмента большущая редкость. Высокие, как и в UP5, не стали выводить на передний план или как-то искусственно подсвечивать, оттого аппарат очень щадяще относится ко всякой грязи и искажениям данного диапазона. При этом все нюансы буквально как на ладони. Оттого, на мой взгляд, и чувствуется в звуке эдакий налет музыкальности. Плеер скорее певучий, чем сухой и аналитичный. Ну разве что на фоне UP5, у которого все эти особенности еще сильнее выражены, он кажется резким. Но то лишь на фоне.

По стилистике H05 можно использовать с чем угодно, от сложного инструментального джаза, до скоростной тяжелой музыки и везде аппарат покажет себя с очень достойной стороны. По крайней мере для 160 долларов такой уровень реально удивляет. Прекрасная прорисовка текстур, мелодичность и передача непосредственно музыкального пространства. И если с 3.5 мм еще можно получить какой-то легкий смаз, то на балансе все инструменты имеют четкое разделение и хорошо очерченные границы. Еще раз, это не убийца всего на свете, так как плеер явно проигрывает ЦАПу из этой же ценовой категории, однако если вы хотите отдельное устройство в старом добром стиле, без андроида и стриммингов, то Eros H05 — это как раз то, что вы искали. Звучит он точно дороже своей цены. Однако если вы не гнушаетесь связок, то, как говорится, есть другие варианты.

Из наушников пробовал девайс вместе с Bqeyz Autumn, Kinera Skuld, 7Hz Timeless и многими другими. И если Kinera для данного плеера явно избыточны, он их просто не раскроет, то с Autum, KATO, Aurora и Timeless устройство справляется довольно успешно. В первом случае отлично подчеркивая пространство и глубину тембров, а во втором — всевозможные шлейфы и затухания. Сцену аппарат также прекрасно рисует, причем как в ширину, так и в глубину. Тщательно разделяя планы и контролируя общий баланс частот. Что делает модель применимой не только для акустически простых стилей, но и для оркестровой и другой академической музыки. Да, не идеально, но идеал искать в бюджетном сегменте было бы через чур наивно. А так, мое почтение.

Видеоверсия обзора

Выводы

Итогом, Hi-Fi аудиоплеер Aigo Eros H05 очень меня порадовал качественными компонентами, уровнем сборки и большим 4-дюймовым IPS экраном. Аппарат поддерживает почти все современные форматы, включая Hi-Res, DSD и DXD, может работать как USB ЦАП и имеет целых два выхода: обычный с мощностью до 125 мВт на канал и балансный — до 450 мВт на 32 ома нагрузки. Чего, реально, с избытком для любых наушников. В минусы вынесу несенсорный дисплей, проблему с драйверами в Windows, ну и отсутствие всяких плюшек типа стримминга, блютуз и возможности выступать в качестве цифрового источника. В остальном же у девайса одни только плюсы.

По подаче с 3.5 мм выхода звук теплый и скорее музыкальный, а вот по балансу все уже куда серьезнее: четкий, с отличными атаками, но при этом достаточно мелодичный и выразительный. Отдельно хочется отметить уровень артикуляции вокала и разделения планов, что в данном сегменте довольно большая редкость.

На мой субъективный взгляд, Eros H05 звучит заметно дороже, чем стоит и только лишь ЦАПы из той же ценовой категории способны составить ему ну хоть какую-то конкуренцию. А мы помним, что обычно ЦАП заметно переигрывает плеер в этой же цене, поскольку первый технически сложнее и дороже в производстве. Так что Aigo нам очередной доказала, что плееры вполне способны показать класс, не взирая на ценовую нишу и всеобщую популярность мобильных ЦАПов. Молодцы, с удовольствием гоняю Eros H05 уже почти пол года и нареканий к нему вообще нет — разве что хотелки.

УЗНАТЬ АКТУАЛЬНУЮ ЦЕНУ НА Aigo Eros H05

«Зениту» надо нацелиться на четвертьфинал Лиги Европы»

Специально для bobsoccer.ru экс-футболисты «Зенита» разных поколений и разных амплуа, выигрывавшие Кубок и чемпионат страны, вспоминают уходящий год и делятся ожиданиями о будущем петербургского клуба.

С пользователями нашего портала делятся впечатлениями опорный полузащитник Сергей Веденеев (чемпион СССР 1984 года), атакующий полузащитник Роман Широков (обладатель Кубка УЕФА и Суперкубка Европы), голкипер Вячеслав Малафеев (пятикратный чемпион России), нападающий Станислав Крапухин (чемпион России 2020/2021 года) и защитник Константин Лепехин (обладатель Кубка России 1999 года).

Сергей Веденеев: «Уходящий год запомнился появление Клаудиньо и изменением игры»

Чем запомнился уходящий год в исполнении «Зенита»?
Константин Лепехин:
— Продолжением доминирования в российском чемпионате. Все ждут, что кто-то когда-то навяжет борьбу «Зениту», но пока никакой конкуренции в РПЛ нет.

Сергей Веденеев:
— Появлением Клаудиньо, изменением игры в сторону комбинационного футбола. С возрастанием бразильской диаспоры перестраиваются не только партнеры, но и тренерский штаб. Часто бывает, что с приходом новых футболистов меняется внутрикомандная структура, отношения – возможно, этим объясняется отсутствие стабильности. А вот по Лиге чемпионов особо вспомнить и нечего.

Вячеслав Малафеев:
— Думаю, в первую очередь интересной и достойной игрой в Лиге чемпионов, домашние матчи против «Челси» и «Ювентуса» оставили приятное послевкусие от группового этапа. Пускай «Зенит» и не смог пройти дальше в этом розыгрыше Лиги чемпионов, но, во всяком случае, все было не так однозначно, как в прошлом году, игра команды в некоторых моментах вселяла надежду на положительные исходы против грандов мирового футбола.

Станислав Крапухин:
— Чемпионством и ничьей с «Челси» в Лиге чемпионов.

Роман Широков:
— Очередным чемпионством и несколькими красивыми разгромами.

Добивается ли «Зенит» баланса в соотношении «игра – результат»?


Лепехин:
— На мой взгляд, особого движения нет. В РПЛ на протяжении трех последних лет ничего не меняется, хотя соглашусь, в этом сезоне петербуржцы стали больше играть низом.

Веденеев:
— И раньше баланса особо и не было, что связываю с большой занятостью игроков в национальных сборных и участием в международных матчах. Но, повторюсь, игра «Зенита» стала более приятна для восприятия, петербуржцы атакуют числом и умением, есть, кому отдать и кому забить. При этом в РПЛ остается и результат.

Малафеев:
— В чемпионате России, безусловно, такой баланс есть. В Лиге чемпионов посложнее, что в целом не должно вызывать каких-то удивлений.

Крапухин:
— Добивается и ещё как, в этом большая заслуга Сергея Богдановича.

Широков:
— В России по большей части да, но в Европе надо добавить.

Лучший игрок «Зенита» на этом отрезке сезона?

Лепехин:
— Ракицкий.

Веденеев:
— Такого игрока, который бы стабильно выделялся на общем фоне, в «Зените» нет. В концовке после завершения периода адаптации самой заметной фигурой был Клаудиньо. В начале чемпионата лидером являлся Азмун. В первых играх много забивал Ерохин. Но стабильно никто эту часть сезона не отыграл.

Малафеев:
— Мне, как и многим поклонникам футбола, импонирует стабильность, с которой выступает Ярослав Ракицкий. Человек играет полезно и ровно чуть ли не с того момента, как пришел в клуб. Естественно, отметил бы игру и другого легионера — Клаудиньо. Техника, мастерство и желание, с которым выходит на поле бразилец, приносит пользу для всей нашей команды, его самоотдача помогает клубу в ключевые моменты игры.

Крапухин:
— Однозначно Клаудиньо, игрок точно уровня топ-5 лиг. Уверен, что «Зенит» для него только трамплин.

Широков:
— Если речь об осени, то, наверное, Клаудиньо, по году в целом Азмун.

Вячеслав Малафеев: «Сейчас в трансферах во вратарскую линию нет никакого смысла»

Спокойны и уверенны ли вы за вашу позицию в «Зените»? Необходимы ли трансферы в эту линию?
Лепехин:
— В РПЛ в индивидуальном плане центральные защитники выглядят надежно и уверенно, а вот для удачного выступления в международных соревнованиях «Зениту» однозначно необходимо усиление.

Веденеев:
— Я думаю, в плане отбора лучше Барриоса «Зениту» не найти. Единственный момент: входящий в тренерский штаб Тимощук, который на этой позиции, что называется, собаку съел, должен постоянно работать с Барриосом над совершенствованием игры. Здоровья и интеллекта у колумбийца более, чем достаточно, чтобы покрывать большие расстояния и занимать правильную позицию, однако кое-какие нюансы еще есть – например, ему надо руководить действиями партнеров в своей штрафной при плотном насыщении. С командами среднего уровня опорная зона «Зенита» выглядит нормально даже с учетом позиционных ошибок центральных защитников, но когда «Зенит» встречается с более сильными соперниками, в центре не хватает Оздоева, который наряду с Барриосом, пусть и в ущерб созидательным действиям, цементировал середину поля. Кузяев и Вендел не опорники, с бразильцами вряд ли можно добиться прогресса на этой позиции. Барриос в центре обороны? По сути, он оставался опорным, лишь опускаясь ниже и заполняя зону между Чистяковым и Суторминым.

Малафеев:
— На сегодняшний день на этой позиции конкурирует два возрастных опытных игрока. Что Михаил, что Станислав – равные и мастеровитые вратари. Считаю, что на данный момент в трансферах в эту линию нет никакого смысла, необходимо определяться по сегодняшней обойме, так как и у Михаила, и у Станислава краткосрочные контракты. Если закладывать что-то на перспективу, то, конечно, необходимо кого-то брать на «карандаш», как говорится, следить за кем-то. Нужно четко понимать, какие цели и задачи у клуба стоят по вратарской позиции.

Крапухин:


— При наличии Азмуна и Дзюбы я спокоен, но если хотя бы один из них выпадет, тогда начнутся проблемы. Думаю, зимой будет трансфер на эту позицию.

Широков:
— В середине поля в целом да, но нет пределу совершенству! (Смеется). Думаю, эти ребята добавят ещё. Трансферы все-таки не помешают – скажем так, в части укрепления скамейки, что явно продемонстрировал матч с «Динамо».

Станислав Крапухин: «Запаситесь попкорном – нас ждет увлекательная концовка сезона!»

Ваш прогноз на выступление «Зенита» в весеннем отрезке сезона – чемпионат и Кубок России, Лига Европы?
Веденеев:
— Если игроки не будут массово выпадать из-за травм и дисквалификаций, в чемпионате «Зенит» должен докатить до золота. Лига Европы непредсказуема, в ней немало сильных команд. В последние годы испанцы удачно играют с российскими клубами за счет того, что оставляют наших ребят без мяча. Тоже самое можно сказать и про Кубок – в играх на вылет возможен любой исход. К тому же в Кубке перед тренером всегда встает дилемма: дать шанс запасным, или поставить основу. Это тоже может повлиять на выступление «Зенита».

Лепехин:
— Чемпионат будет продолжаться в таком же ключе: «Зенит», допускаю, и без феерии, но выиграет чемпионство. Выступление в Кубке России зависит от ситуации на день игры: состояние футболистов, состав, настрой. Если Семак выставит основу, победа в этом турнире весьма вероятна. Лига Европы? В случае прохода «Бетиса» оценка выступления в международных турнирах будет положительной.

Малафеев:
— С большей долей вероятности ожидаю увидеть «Зенит» чемпионом страны, результаты в матчах с принципиальными соперниками и игра команды в целом достойна титула. Что касается Кубка России и Лиги Европы, то здесь все будет не так просто, плюс, как мне кажется, приоритеты клуба вполне очевидны.

Крапухин:
— Победа в чемпионате, выход в четвертьфинал Лиги Европы, выигрыш Кубка России. Главное, собрать обойму к этому отрезку сезона, нас ожидает интересное трансферное окно.

Широков:
— В чемпионате России и Кубке – борьба за трофей. В Лиге Европы нужно нацеливаться на четвертьфинал.

Что пожелаете болельщикам «Зенита» в Новом году?
Лепехин:
— Поддерживать свою команду не только, когда она становится чемпионом и забивает по семь голов, но и в сложные моменты. К сожалению, у нас многие отворачиваются, когда что-то начинает идти не так. Настоящим болельщикам желаю быть с «Зенитом» в любой ситуации.

Веденеев:
— Так же болеть, переживать, ругать, прощать и поддерживать (Улыбается)

Малафеев:
— Здоровья и счастья. Всего самого доброго в Новом году!

Крапухин:
— Болельщикам желаю только одного – чтобы они увидели, как Кубок УЕФА (титул обладателя Лиги Европы) возвращается в Санкт-Петербург! Запаситесь терпением и попкорном: нас ждёт увлекательная концовка сезона!

Широков:
— Чтобы все плохое осталось в пошедшем году, а все хорошее перенеслось в Новый Год! И, конечно, побед любимой команды!


Фото: fc-zenit.ru

Курсы «АвтоПрофи»

О нас

Основная задача нашего учебного центра — реализация практических программ профессиональной подготовки, переподготовки и повышения квалификации работников автосервиса.

Мы предоставляем возможность слушателям работать со специализированной современной техникой, аналогов которой нет в других учебных центрах.

Класс теоретического обучения

В классе предусмотрены:
— 16 рабочих мест учащихся;
— рабочее место преподавателя, оборудованное интерактивной доской;
— учебно-наглядные пособия в виде реальных современных агрегатов автомобиля с разрезами и стендов систем автомобиля.

Лаборатория Uni Train

В лаборатории Uni Train предусмотрены: 16 рабочих мест, оборудованных ноутбуками с программным обеспечением «Автодиагностика» и установками Uni Train, рабочее место мастер-тренера, оборудованное интерактивной доской, учебно-наглядные пособия в виде реальных современных агрегатов автомобиля с профессионально выполненными разрезами и стендов систем автомобиля.

Программное обеспечение «Автодиагностика» позволяет обучающимся осуществлять поиск неисправностей электронных систем автомобиля в виртуальном пространстве, тем самым формируя профессиональные умения и отрабатывая навыки.

Мастер-тренер со своего рабочего места может задавать обучающимся более 50 различных неисправностей. Обучающиеся, пользуясь виртуальными диагностическими средствами, находят неисправность и устраняют её, а программа начисляет за выполненное задание баллы.

Лаборатория электронных систем

В лаборатории электронных систем предусмотрены: 13 учебных стендов, оборудованных компьютерами с программным обеспечением для задания неисправностей системы и их поиска; диагностическое оборудование для поиска и устранения неисправностей (сканеры, мультиметры, осциллографы).

На базе лаборатории электронных систем проводятся тренинги, направленные на закрепление ранее полученного теоретического материала, по следующим темам:

— система энергоснабжения автомобиля;
— система освещения автомобиля;
— системы кондиционирования и климат-контроля;
— система питания дизельного двигателя Common Rail;
— система питания бензинового двигателя с непосредственным впрыском топлива FSI;
— система питания бензинового двигателя с распределенным впрыском топлива;
— тормозная система с АБС;
— автосигнализация автомобиля с обратной связью;
— генераторная установка автомобилей;
— системы пассивной безопасности автомобилей;
— гибридные силовые установки.

Лаборатория диагностики

В лаборатории диагностики предусмотрены:
— действующий дизельный двигатель с системой питания Common Rail;
— легковой автомобиль со встроенным имитатором неисправностей;
— шасси легкового автомобиля с действующим бензиновым двигателем с распределенным впрыском;
— мотор-тестер Bosch FSA 760;
— диагностический сканер Bosch KTS 540;
— учебно-наглядные пособия в виде реальных современных узлов автомобиля с разрезами.

Именно здесь обучающиеся отрабатывают свои ранее сформированные профессиональные навыки в реальных условиях.

Лаборатория топливной аппаратуры

В лаборатории топливной аппаратуры предусмотрены: стенд для диагностики форсунок (механических и Common Rail) Bosch EPS 200; стенд для диагностики ТНВД и форсунок Bosch EPS 708; оборудование для ремонта инжекторов Common Rail по заводской технологии Bosch STEP 3.

Лаборатория по изучению устройства электромобилей

В наши ближайшие планы входит открытие лаборатории по изучению устройства электромобилей. В настоящее время мы ведем активную работу по оснащению этой лаборатории.

В данный момент мы рады представить Вашему вниманию:
-комплектный электромобиль Nissan LEAF;
-разрез электромобиля Nissan LEAF ;
-диагностическое оборудование;
-зарядная станция.

Подведем итоги… печальное…: taksisto — LiveJournal

Вот и заканчивается 2021 год… С какими результатами пришла Украина к окончанию года? С плачевными и безрадостными…

Начнем по порядку.

Первое и главное – это полное разочарование в президенте Украины – Зеленском… Все данные им в 2019 году так и не были исполнены. Жизнь на Украине стала тяжелей и хуже, чем даже при Порошенко. А ведь я еще в 2019 году, когда мне писали жители незалежной, что «будет все прекрасно», откровенно им говорила – будет намного хуже. Но многие считали, что я «глупа и необразованна», что «вот придет совершенно новый человек, не олигарх и обязательно закончит войну и станет «народным президентом»

Ну как стал «народным президентом»?

Коммунальные платежи – это отдельная плачевная история незалежной. В будущем году, при уже в конце года поднявшимся тарифам, было дано обещание МВФ поднять тарифы для населения еще в 2,5 – 3 раза. Уж не знаю куда выше. А в целом тарифы за 2021 год выросли на 50-80%.

Продовольственное обеспечение продуктами питания незалежной – это то, что сегодня не имеет никакого будущего на Украине. В связи с высокими тарифами на газ, хлеб становится золотым. На очереди молочная промышленность и даже мясная.

Нищета… как рассказывают мои знакомые из Украины – в магазинах есть все… тут нужно поставить слово «пока», хотя будут из европ привозить продукты, вопрос – а как с покупательской способностью?

Многие хлебзаводы на грани закрытия, собственники пекарен уже предупредили реализаторов продукции о грядущих перебоях с поставками.

Из-за рекордных скачков цен на газ хлеб в стране подорожает на 30%, предупредили во Всеукраинской ассоциации пекарей. По словам президента пекарской организации Юрия Дученко такая мера необходима для «выживания» хлебной отрасли на Украине.

Но газовый кризис коснётся не только хлеба. Одна из самых известных кондитерских компаний Украины «Roshen», а также ещё 26 предприятий по производству сладостей объявили о вероятной приостановке производства. Такое заявление от имени компаний сделала ассоциации «Укркондпром», куда входят украинские производители кондитерских изделий.

Теперь остаётся надеяться лишь на американские печеньки и сладкие воспоминания о скачках на Майдане.

И только жена Зеленского и украинские депутаты живут на Украине в каком-то параллельном мире, рассказывая украинцам о рыбе за 8 грн. за кг и как заявил Тищенко «гречка стоит 12 грн за кг, сало – от 50 грн, а говядину на Бессарабском рынке покупал за 50-70 грн и видел ее по 20 грн»…

Образование и полная деградация населения, в том числе подрастающего поколения – знания на нуле. Сколько там сдали тестовые экзамены на отлично – 0,1% школьников? Отсутствие грамотных учителей, полное обучение на украинской мове, мнимый патриотизм, это все что может дать детям сегодня украинская школа…

В последние годы на Украине заметно ухудшилось качество учебников и квалификация преподавателей, а сомнительные «реформы» приведут к тому, что уже скоро школьники не будут знать ни украинского, ни русского языка…

Киевские власти слишком рьяно хоронили то лучшее, что осталось от СССР. И теперь главная задача современного украинского образования — создать человека, который будет обладать сугубо прикладными знаниями. Это и понятно: в стране выпускник всё равно работать не сможет и, скорее всего, поедет в Европу, чтобы трудиться на низкоквалифицированных должностях… В итоге Украина в будущем рискует получить малообразованное население…

Ну к этому и стремятся на Украине, не так ли?

Пандемия… коронавирус…

Эта болезнь мощно шандарахнула по Украине… В сводках вы не найдете реальной статистике незалежной… её просто скрывают, по одной простой причине – придете в ужас не только вы, а сами украинцы…

Антисанитария во всех медицинских учреждениях, полное отсутствие финансирования, платные услуги, которые сегодня украинцам не по карману.

Сегодня по Украине начал шагать штамм «омикрон», который косит население уже двумя косами.

Вакцинация населения просроченными вакцинами, сокрытие статистики умерших от вакцинации… Однако все равно российский «Спутник V» для них не такой…

В обещание, что деньги «пойдут за пациентом», в 2021-м перестали верить и больные, и сами врачи. Нет качественных лекарств, доступных цен на медикаменты, нормальных условий в больницах, достойных зарплат медикам. Хотя доплаты медработникам ковидных больниц пообещали, но получали их далеко не все. А нередко деньги приходилось «выбивать» с помощью протестных акций.

Создается впечатление, что украинской власти выгодно, что бы умерли как можно больше людей… Чем вам не геноцид?

А зато Зеленский за деньги на коронавирус строит дороги, только результат нулевой, как были дороги плохими, так и остались… кроме нескольких незначительных трасс…

Центр Разумкова в очередной раз решил задать вопрос украинцам: какое политическое событие вы бы назвали «Событием» в 2021 году, и вот что ответили украинцы:

Правда куда делись еще 15,7% опрошенных, я так и не поняла…

Но, что примечательно, большая часть населения так и не смогла ответить на этот вопрос… Ну, а о плачевном состоянии самой страны, вероятно и высказались эти 15,7% опрашиваемых… но такие ответы сегодня публиковать на Украине явно нельзя…

Что-то мне подсказывает, что это те, кто еще остались адекватными…

Инфляция и отток инвестиций… тут нечего писать, достаточно вспомнить небольшой эпизод: итальянский инвестор, снял все свои солнечные батареи в Днепропетровской области и был таков… из страны уходит больше инвесторов, чем в нее приходит. Украина рассматривается как обезьяна с гранатой…

«Посол Украины в Италии Евгений Перелыгин сетует, что все его попытки сформировать позитивный имидж Украины бессмысленны, пока в стране ущемляют интересы инвесторов. «Что бы я ни говорил здесь, в Италии, о нашей судебной реформе, мне теперь будут показывать письмо группы Unicredit о судейском беспределе в Украине и спрашивать: где же эти изменения?» — заявил посол. Кроме того, у европейских производителей на украинском рынке появилась архисерьезная проблема: их продукция, оказывается, не соответствует украинским стандартам», ― написал Медведчук…

Госкомитет по стандартизации угрожал итальянским производителям бытовой техники Indesit и Delonghi закрыть доступ на украинский рынок как раз из-за несоответствия неким стандартам.

«Вот это размах! Вот это амбиции! Реформ в стране нет, зато какие требования у чиновников: теперь не украинская продукция должна соответствовать европейским стандартам, а европейская ― нашим, украинским, еврореформаторским. Таковы новые украинские реалии. Вот только, столкнувшись с ними, иностранный инвестор решает как можно скорее бежать из Украины», ― заключил Медведчук.

«В уходящем году кризис на Украине углубился во всех сферах, главная же угроза заключается в том, что мировые игроки решают судьбу Украины без Украины. Если США и Россия договорятся, это может быть плохо для Украины, если не договорятся, будет еще хуже: тогда страна может стать театром боевых действий» — пишет «Украина.ру»

2021 год на Украине запомнится не громкими победами и достижениями, а громкими провалами власти во главе с Зеленским. В уходящем году Зеленский многократно нарушал законы и конституцию, использовал правоохранительные органы для подавления оппозиции, не достиг никакого прогресса по Донбассу, допустил рост тарифов и цен, провалил кампанию вакцинации населения и закрывал глаза на пугающие масштабы коррупции, став частью коррумпированной системы.

СНБО Украины в этом году стал органом с несвойственными ему полномочиями. Помимо санкций против граждан Украины, вопрекикКонституции под удар попали оппозиционные Зеленскому СМИ. СНБО незаконно запретил вещание телеканалов «112 Украина», NewsOne и ZIK, а вещание канала «Перший Незалежный», созданного журналистами, было прекращено по звонку из СБУ через час после выхода в эфир. Незаконные санкции были введены против изданий «Страна.юа» и «Шарий.нет». Адекватных причин для этого не было: только пустые обвинения и никаких доказательств.

За этот год Зеленский проявил полную некомпетентность и нежелание в решении вопроса мира на Донбассе. Он не освободил ни единого украинца, и более того — препятствовал освобождению тех, кого в ДНР и ЛНР хотели передать Украине.

«Вместо того, чтобы отвечать на запрос людей о мире… президент Зеленский… подпал, как и прежние руководители под влияние радикальных элементов, как в Украине говорят «нациков»… Мы же хотим выстроить добрососедские отношения с Украиной. Мы идем практически на всё, но как можно выстроить отношения с сегодняшним руководством? С учётом того, что они делают практически невозможно, но мы готовы работать с теми силами, которые хотели бы выстроить хорошие отношения с Россией. Что происходит с этими силами? Внесудебные расправы, санкции против своих граждан, что противоречит законам, Конституции Украины, или просто убийство на улице», — сказал В.Путин.

Все, что мы увидели в 2021 году в отношении Донбасса – это громкие патриотические лозунги вместо реальных смыслов.

Я уже не говорю о скачущих по всей стране неонацистах, которые делают, что хотят и никто их не останавливает…

А одним из самых знаковых подарков под новогоднюю ёлочку на Украине – стал военный учет и мобилизация для украинских женщин…

Украинских женщин мне конечно жалко ровно настолько, насколько они – женщины… Не место им на войне. Ровно как и детям, и старикам. На войне вообще никому не место, но этим – уж точно.

Но! Прежде чем лить слёзы и записывать видосики для Зеленского, прежде копить на взятку военкому или на билет в Европу или в Россию (а куда ещё?), пусть эти женщины посмотрят вокруг себя – и в зеркало. Внимательно посмотрят. И увидят там малоношеную шубу и почти новые ковёр, стиральную машинку, телевизор, которые их мужья и отцы привезли из Донбасса. Часто – со следами крови. А в зеркале увидят тех, кто эти самые «трофеи» заказывал. Тех, кто громче остальных кричал: «Распни!»

Однако, если укропы позволят Зеле и стоящим за ним англосаксам превратить в пушечное мясо их женщин – гарантию их будущего – им даже осина уже не поможет…

Тут один «умный» украинец, Александр Кочетков счел резонным отправку подростков на фронт в случае агрессии со стороны России. Об этом он написал в издании «Главред».

Он высказал мнение, что в войне средний уровень подготовки бойцов не так важен. Важно лишь количество обороняющихся, которые способны стрелять в сторону врага. «При массовой стрельбе сработает теория вероятностей, и пули со снарядами цель найдут», — уверен эксперт.

В общем все печально… как таковой Украины уже давно нет… есть территория, где отдельно друг от друга живет власть и народ… где можно убить и украсть, где можно обидеть слабого и никому до этого нет дела… где память и правда смешаны с грязью… где народ забыл, что они потомки Победителей…

Как-то мне на глаза попалась статья, почему на Украине никто не сопротивляется… кто-то говорит, что они поставлены на грань выживания и им некогда думать о «правде и истории»… Нет мои дорогие украинцы… вы забыли, что мы живем ради будущего своих детей! Так какое будущее вы им готовите? Пока я вижу только одно – страшное!!!

Может пора подумать о своих детях? Ведь никто и никогда не поможет, пока вы будете все ниже склонять голову перед негодяями… Только тот достоин помощи, кто борется…

Всему свое время…

Ваш Таксист…

Публикация Фэйт Рингголд на ткани — PARSE

Художественная карьера Фейт Рингголд, насчитывающая более пяти десятилетий, включает активную деятельность, писательское мастерство, а также перформанс и создание картин, политических плакатов и лоскутных одеял. Рингголд родилась в Гарлеме, штат Нью-Йорк, в 1930 году. Она афроамериканская художница, которую историк искусства Джулия Брайан-Уилсон признала в контексте США «одной из первых феминисток, включивших текстиль в свою практику.” 1 Опубликованные ею сочинения включают многочисленные детские книги и мемуары, Мы летели над мостом (1995). Несмотря на широкое признание, собственное признание Рингголд того, что «я не могу жить в этом мире, не осознавая, что раса и пол влияют на все, что я делаю в своей жизни», представляет нам пересекающуюся политику, которая долгое время влияла на ее карьеру. 2 В этом письме я отхожу от некоторых из наиболее хорошо отрепетированных аспектов карьеры Рингголд как активиста, 3 художника, 4 и художника перформанса, 5 , чтобы сосредоточиться на одном конкретном аспекте ее художественной практики. : взаимосвязь между текстом и текстилем, обнаруженная в стеганых одеялах Рингголд, и события, которые заставили ее использовать текстиль как поверхность, на которой она могла публиковаться.

В публичном диалоге с художественным руководителем Serpentine Galleries Хансом Ульрихом Обристом, который сопровождал ее одноименную персональную выставку в Лондоне (6 июня — 8 сентября 2019 г.), Рингголд рассказала о реакции своего первоначального издателя на ранний черновик своих мемуаров, впервые названный Being Моя собственная женщина , которая в конечном итоге будет опубликована как Мы летели над мостом :

Она [издатель] сказала, что это не ваша история. И я сказал, о боже.Во-первых, она сказала раньше, что собирается издать мою книгу. Не знаю, почему она просто посмотрела на меня и решила, что моя книга будет односторонней. А это было не так. Итак, когда я дал ей свою автобиографию, выросшую в Гарлеме и поступившую в Городской колледж, и все испытания и невзгоды, она решила, что это не ваша история. Потому что большинство писателей, чернокожих женщин-писателей, писавших свои рассказы в то время, писали рассказы обо всех ужасах, которые им принесла их жизнь.Мне жаль. Моя жизнь не была ужасом. Меня не изнасиловали, не выбросили в окно, не избили и все такое. Со мной этого не случилось. Итак, что мне делать? Сделайте это так, чтобы меня опубликовали? И, может быть, некоторые из них тоже так поступили. Я не знаю. Но я решил, что хочу рассказать свою историю. 6

Когда Обрист спросил Рингголд, как она пришла к формату лоскутного одеяла рассказа, она вернулась к теме публикации: «Ну, как я могу быть опубликован? Как я могу сказать свое слово? » 7 «Это можно сделать, написав это на моем произведении искусства.Напиши это. Никто не может помешать мне это сделать. У меня есть речь по этому поводу ». 8

Там, где Рингголд рассказала о проблемах, с которыми она столкнулась при публикации своих мемуаров, Керли Рэйвен Холтон добавляет, что Рингголд «называли феминисткой, но она быстро напоминает нам, что феминистское движение, естественно, не искало лиц, которые выглядели как ее. » 9 Американский историк искусства Алисса Аутер отмечает, что «поиск Рингголд и других художников-феминисток художественной самобытности вне мейнстрима тесно связан с их законным желанием профессионально заниматься в мире искусства, враждебном их присутствию. 10 «В случае Рингголда это было утверждение расовой идентичности в искусстве, которое неизбежно поставило под сомнение маргинализацию западного африканского искусства как ремесла». 11

Вспоминая свое детство, Рингголд отмечает: «Я выросла в Гарлеме во время Великой депрессии. Это не значит, что я был бедным и угнетенным. Нас защищали от притеснений и нас окружала любящая семья ». 12 В случае Рингголд первоначальная «неспособность» ее биографии в глазах ее первоначального издателя рассказать о переживании бедности или насилия, которое она фактически не пережила, вдохновила ее на решение вместо этого обратиться к письму. текстиль.«Позже Фейт отметит, что это было началом включения фактического письменного текста в ее работу и, возможно, началом ее формальной карьеры писателя». 13 По иронии судьбы обращение к ткани в качестве места публикации также вовлекло практику Рингголд в дебаты о ценности искусства по сравнению с ремеслом, которые рисковали усугубить маргинализацию, которую она уже испытала в силу своего пола и расы. Автор отмечает: «Важно отметить, что исследование Фейт Рингголд разделения искусства и ремесла продемонстрировало, что эти отношения были обусловлены не только полом, но и расой, расширив феминистскую критику эстетической иерархии за пределы ее связи с домашней сферой.” 14

Лоскутное одеяло как рассказчик

Лоскутное одеяло появляется в широком диапазоне культурных контекстов и исторических моментов в качестве рассказчиков — иногда рассказчиков под принуждением. Во время диктатуры генерала Пиночета в Чили (1973–1990), по сшитому текстилю arpilleras , вывезенному контрабандой из страны, объявлены пропавшие без вести мужья, сыновья и братья тех, кто сшил ткани до других форм сообщений, таких как радио и газетная бумага. 15 В Зимбабве такие проекты, как Weya Appliqués, сшитые в конце 1980-х — начале 2000-х годов, также являются частью традиции рассказывания историй, первоначально финансируемой за счет туризма, но в конечном итоге затрагивающей такие темы, как эпидемия ВИЧ / СПИДа. 16 Совсем недавно выставки, такие как «Жизнь на окраинах» на острове Спайк, Бристоль, отметили карьеру филиппинской американской художницы Паситы Абад (1946-2004), чьи крупномасштабные работы сочетают живопись и trapunto и имеют сходство с эстетикой Рингголда. . 17 Сама Рингголд писала о работах Абада: «Много путешествующий, Абад создает свои работы с точки зрения международной цветной женщины. Те из нас, кто также много путешествовал, знают, что цветные творческие женщины работают по всему миру, а не являются просто фигурами «меньшинства» в узких рамках западного мира искусства.” 18

Рисунок 1: Последовательность: Pacita Abad, Если бы мои друзья могли видеть меня сейчас , 1991, акрил, раскрашенный холст, золотая пряжа на простроченном и набивном холсте; L.A Liberty , (реверс), 1992, акрил, хлопчатобумажная пряжа, пластиковые пуговицы, зеркала, золотая нить, расписная ткань на простроченном и набивном холсте; Life in the Margins , 2020, вид из инсталляции, Остров Спайк, Бристоль. Работы любезно предоставлены Художественным музеем Пацита Абад, фотография Макса Макклюра

Но афроамериканский ученый Белл Хукс также предостерегает от широких сравнений.Она называет, без использования этого термина, то, что мы сегодня можем назвать признанием интерсекциональности в работе:

Работа чернокожих женщин-мастериц требует особого феминистского критического комментария, учитывающего влияние расы, пола и класса. Многие чернокожие женщины стегали стеганые одежды, несмотря на тяжелые экономические и социальные обстоятельства, которые часто требовали проявления творческого воображения способами, радикально отличавшимися от таковых у белых женщин-сверстниц, особенно у привилегированных женщин, у которых был больший доступ к материалам и времени.Часто черные рабыни стегали стеганые одежды как часть своей работы в домашних хозяйствах белых . 19

Предлагаемые предупреждающие крючки применимы к чтению лоскутных одеял Рингголда, чья семейная история связана с опытом порабощенного труда: «Вилли Поузи [мать Рингголда] рассказала, как ее бабушка Бетси Бингхэм кипятила и отбеливала цветочные мешки, чтобы выровнять одежду. одеяла она сшила. Сьюзи Шеннон, мать Бетси, была рабыней в довоенной Флориде и шила лоскутные одеяла в рамках своих обязанностей. 20

Производство текстиля, особенно хлопка, и американское рабство были взаимозависимыми.Как отмечает Свен Бекерт в своем обширном исследовании истории хлопка, «хлопок требовал буквально охоты за трудом и постоянной борьбы за его контроль […] сопутствующее физическое и психологическое насилие, связанное с удержанием миллионов в рабстве, имело центральное значение для расширения производство хлопка в Соединенных Штатах и ​​промышленная революция в Великобритании ». 21 В то время как предупреждение Хукса верно в отношении семейной истории Рингголда, она также рискует навязывать автобиографическое ожидание работе аналогично раннему опыту Рингголда в публикации.Лоскутные одеяла, несмотря на всю их способность рассказывать истории, также подвергались чрезмерным претензиям в отношении их повествовательного влияния.

Один из примеров увеличения повествовательного потенциала лоскутных одеял можно найти в том вкладе, который лоскутные одеяла, возможно, внесли в порабощенных людей, перемещающихся по Подземной железной дороге. 22 Жаклин Л. Тобин и Раймонд Дж. Добард опубликовали широко оспариваемую книгу, в которой утверждали, что лоскутные одеяла буквально содержат в своих выкройках коды, которые направляют порабощенных людей, которые путешествовали к своей свободе в американских штатах, где рабство было незаконным. 23 Предположение о том, что эти коды, пересказанные через устную историю, переданную одной из владельцев лоскутного магазина, Озеллой Уильямс в Чарльстоне, Южная Каролина, функционировали как закодированные карты, было решительно оспорено, возможно, наиболее эффективно благодаря базовому признанию того, что путешествие происходило пешком ночью. где развешивание одеял в качестве маркеров или карт не только вызвало бы подозрения, но и было бы невозможным для тех, кто путешествовал под покровом темноты. 24 Как пишет Фергус М. Бордевич:

Важность подземной железной дороги заключается не в фантастических легендах, а в разнообразной истории мужчин и женщин, черных и белых, которые заставили ее работать и в далеком прошлом. -достижение политических и моральных последствий того, что они сделали.Подземная железная дорога была первым крупным национальным движением массового гражданского неповиновения после Американской революции, вовлекшим тысячи граждан в активный подрыв федерального закона, а также первым массовым движением, которое провозгласило принцип личной ответственности за права человека других. Это было также первое межрасовое политическое движение в стране, которое с момента своего зарождения в 1790-х годах объединило свободных чернокожих, белых аболиционистов, а иногда и рабов, в сотрудничестве, которое разрушило расовые табу . 25

Работа Тобина и Добарда о подземной железной дороге превратила потенциал в факт, но в отсутствие существенных подтверждающих доказательств. Для многих других примеров во всем мире текстиль и, возможно, лоскутное одеяло в частности, действительно заслуживают признания не только как рассказчики, но и как рассказчики, способные сообщать альтернативные и несанкционированные версии истории. Верно и обратное: лоскутное одеяло как структура, метафора и символ появляется и способствует написанию художественной литературы.

Литературные лоскутные одеяла

Стипендия о появлении лоскутного шитья в американской литературе включает в себя прочтение Элейн Шоуолтер сходства между лоскутным одеялом и повествовательными структурами в письме американских женщин девятнадцатого и двадцатого веков. 26 Шоуолтер пишет: «Я хотел бы предположить, что знание кусочков, техники сборки фрагментов в замысловатый и гениальный дизайн, может обеспечить контексты, в которых мы можем интерпретировать и понимать формы, значения и повествовательные традиции Письмо американских женщин. 27 Во многом похоже на крючки, и несмотря на ее энтузиазм по поводу ряда обстоятельств, в которых происходило и происходит квилтинг, 28 Шоуолтер призывает обратить внимание на конкретные контексты: «чтобы понять взаимосвязь между присваиванием по кусочкам и письмом американских женщин. , мы также должны демантизировать искусство стеганого одеяла, поместить его в его исторический контекст и отбросить многие из сентиментальных стереотипов идеализированной, сестринской и неиерархической женской культуры, которые цепляются за него.” 29

Шоуолтер далеко не единственная в своем исследовании. Санни Падающий дождь использует аналогичную стратегию чтения, чтобы проследить структуру того, что она считает сумасшедшим лоскутным одеялом в романе Тони Моррисон Любимое (1987):

Моррисон буквально создал сумасшедшее лоскутное одеяло. Каждая составляющая сумасшедшего лоскутного одеяла имеет аналог в романе. Диапазон литературных приемов, использованных для превращения романа в сумасшедшее лоскутное одеяло, включает прямые высказывания о лоскутных одеялах, цветах, тканях и лоскутном шитье, а также их значении в жизни персонажей.Но автор также создал очень тонкие техники для имитации структур квилтинга, методы, которые, как я полагаю, мог заметить только тот, кто разбирается в квилтинге — кто-то ищет структуры, напоминающие сумасшедшее квилт. 30

Я бы добавил, что лоскутное одеяло в Beloved существует не только в остатках ткани и структурах лоскутного шитья, которые следы падающего дождя на протяжении всего романа, но и в цветных пятнах, заявленных на теле:

Ее прошлое было таким же, как ее настоящее — невыносимым, и поскольку она знала, что смерть — это что угодно, только не забвение, она использовала немного оставшейся энергии для размышлений о цвете.

«Если есть, принесите немного лаванды. Розовый, если нет.

И Сете услужила бы ей чем угодно, от ткани до ее собственного языка. Зима в Огайо была особенно суровой, если вы любили цвета. Небо представляло собой единственную драму, и рассчитывать на горизонт Цинциннати для главной радости жизни было поистине безрассудным . 31

Роман Алисы Уокер « Пурпурный цвет » (1982), вдохновивший Рингголда на создание «Пурпурное одеяло » (1986) Рингголда, также оказывает значительное влияние на текстиль и шитье в повествовании. 32 Главный голос книги принадлежит Сели, большая часть книги передана в письмах между Сели и ее сестрой Нетти, которая работает миссионером с вымышленным народом олинка в Африке. Одеяло используется, чтобы вызвать воспоминания о смертном одре Корин, работодателя и коллеги-миссионера Нетти, и подтвердить точное биологическое материнство. 33 Конструирование и пошив брюк позволяет Сели получить некоторые экономические и личные возможности в надомном производстве, которое она называет Folkspants Unlimited. 34 И важность визуальной красоты, обнаруживаемая как в текстиле, так и в текстильных фрагментах в Beloved — видение розового зимой на языке — также очевидна в романе Уокера, когда Шуг, после того, как познакомила Сили с ее собственной сексуальностью , замечает: «Я думаю, что это бесит Бога, если вы проходите мимо фиолетового цвета где-нибудь в поле и не замечаете этого. 35

В ряде случаев крючки также относятся к лоскутным одеялам в ее сочинении. В версиях ее сочинений, опубликованных в The Object of Labor: Art, Cloth and Cultural Production , появляется макет текста и «заплатки», а крючки напоминают эстетическое наследие ее собственного детства. 36 Маленькие белые блоки, лишенные текста, изначально разделяют страницу и нарушают ожидаемые ритмы согласованных столбцов слов. По мере написания хуков некоторые пустые блоки начинают частично заполняться фрагментами изображений из лоскутных одеял Рингголда, сначала незавершенными, а затем постепенно приближающимися к завершению по мере развития письма, предлагая еще один подход к историческим исследованиям Шоуолтера. 37

Лоскутные одеяла Фэйт Рингголд

Стратегия Рингголда по публикации на ткани появилась в 1980-х годах и нашла свое отражение в таких сюжетных лоскутных одеялах, как Кто боится тети Джемаймы? (1983), Одеяло из рассказов об изнасиловании рабов (1985) и Пурпурное одеяло (1986). Ее использование текстильных материалов связано с влиянием ее матери, Вилли Поузи Джонс, местного модельера, и того, что Рингголд просмотрел спасибо картин. 38 Писательница-феминистка Мишель Уоллес, одна из двух дочерей Рингголд, размышляет о том, что ее мать «видела в этих свитках без рамок» тибетских и непальских картин пятнадцатого века thanka в Государственном музее летом 1972 года «решение ее проблемы». проблема с перемещением, хранением и транспортировкой картин […] Картины на танкасах [sic] могли катиться. 39 Сама Рингголд объясняет в интервью 1975 года:

Кто сказал, что искусство — это масляная краска, натянутая на холст с художественными рамками? Я этого не говорил. Никто, кто когда-либо был похож на меня, не говорил этого, так какого черта я это делаю? Так что я просто остановился; а теперь я занимаюсь шитьем и всем остальным. Шитьем традиционно занимались все женщины во всех культурах. Что в этом плохого? С политической точки зрения, я думаю, некоторые женщины, вероятно, сказали бы: «Я не хочу, чтобы меня поместили в сумку [] женского искусства… шитья.«Хорошо, это твой выбор… Я не хочу, чтобы меня поместили в сумку, где, как мне кажется, все искусство состоит в создании чего-то, что никто не может сдвинуть с места». Создание какой-то большой, монументальной, монолитной вещи, которую я даже не могу себе позволить … Феминистское искусство — это мягкое искусство, легкое искусство, искусство шитья. Это уникальный вклад женщин . 40

Уоллес замечает, что серия Slave Rape (1972) «служит предшественницей идеи, более полно воплощенной в сюжетных лоскутных одеялах 1980-х годов» благодаря использованию тканевой рамки, вдохновленной картинами танка и поддерживался руководством шитья матери Рингголд.Каждая работа в серии из трех частей содержит центральное нарисованное изображение обнаженной и частично замаскированной листвой «африканских женщин, сопротивляющихся плену и сексуальному насилию». 41 Работы обрамлены тканевой окантовкой, которая противоречит материальным ожиданиям белого куба о соответствии прямых углов и прямых краев. Возможно, ткань можно было бы сшить более ровно, композиции — более сбалансированными, если бы такая эстетика была желательна. Такая обработка ткани, но не деталей вышивки, является стилистической чертой, которая проходит через всю работу Рингголда с тканью.

Но шитье — это не то, что, как утверждает Рингголд, «делают все женщины во всех культурах». Уокер обращается к этому европейскому и североамериканскому стереотипу в конце серии The Color Purple через диалог между Сили и Альбертом, отчим мужа Сели, по сути, продал ее и подверг ее изнасилованию, которые достигли некоторой формы примирения через их взаимную любовь и неприятие одной и той же женщиной. 42 Сели узнала через миссионерскую работу своей сестры в Африке, что текстильные традиции, такие как шитье, не организованы, как она испытала в Америке, и пытается поделиться этими знаниями с Альбертом.Их диалог представляет собой резкую демонстрацию гендерных норм, с которыми они живут:

Мужчины и женщины не думают носить одно и то же, сказал он. Мужчины предпочитают носить брюки.
Итак, я сказал: «Ты должен сказать это мужчинам в Африке».
Сказать что? Он аст. Впервые он подумал о том, что делают африканцы . […]
И мужчины тоже шьют в Африке, говорю я.
Есть? Он аст.
Да, говорю. Они не такие отсталые, как здесь мужские.
Когда я рос, сказал он, я пытался шить вместе с мамой, потому что она всегда этим занималась. Но все надо мной смеялись. Но знаете, мне понравилось.
Ну, пидор, теперь посмеяться над тобой, сказал я. Вот, помогите мне вшить эти карманы.
Но я не знаю как, говорит он.
Я вам покажу, сказал я. И я сделал.
А теперь сидим, шьем, говорим и курим трубки . 43

Рингголд позже сотрудничала со своей матерью над тем, что считается ее первым стеганым одеялом в 1980 году Echoes of Harlem . 44 Лоскутное одеяло состоит из блоков с раскрашенными лицами без сопроводительного текста, которые Аутер описал как «сшитую сетку из кусочков ткани с сильными отсылками к афроамериканской традиции квилтинга в использовании остатков и импровизационного контраста цветов. и узор », отметив, что Рингголд позже выразила сожаление по поводу того, что не последовала первоначальной идее своей матери относительно границы,« боялась, что узор будет выглядеть непрофессионально. Когда она поняла, каким образом интерес ее матери к изготовлению каймы от руки связан с афроамериканской традицией изготовления лоскутных одеял, она пожалела, что не реализовала первоначальную идею. 45 В диалоге с Обристом Рингголд размышляет о содержании стеганого одеяла:

FR: В 1960-х годах в Гарлеме каждые пять минут на улице происходили беспорядки.

HUO: Вы могли видеть беспорядки на улице, вы их видели, но кадры не транслировались по телевидению или в газетах?

FR: Нет, вообще ничего. Я не мог понять, что вы можете стоять на улице и ничего не увидите в новостях, когда вернетесь домой.Мне пришло в голову, что кто-то хранил информацию . 46

Наблюдение Рингголда можно легко применить к другим контекстам, где текстильное производство было ранним свидетельством насилия, например чилийским arpilleras .

Рисунок 2: Фейт Рингголд, Кто боится тети Джемаймы? , 1983, вид инсталляции Serpentine Galleries, Лондон, холст, акрил, 90 x 80 дюймов / 228,6 x 203,2 см, любезно предоставлено художником и галереями ACA, Нью-Йорк, штат Нью-Йорк

Указано как ее первое лоскутное одеяло для рассказа, Who’s Afraid of Aunt Jemima ? (1983) 47 использует 56 панелей, чтобы рассказать альтернативное повествование о лице американского бренда блинов, «преобразованном в черную феминистскую икону, женщину, преуспевшую в бизнесе, привлекательную, юную и никому не подчиненную. 48 Рингголд охарактеризовал прием лоскутного одеяла в то время как «очень противоречивый» и пояснил, что в своей версии истории тетя Джемайма — предприниматель. 49 Текстовые панели идут сверху вниз, но читаются справа налево, за исключением последней панели, которая центрируется в нижней части лоскутного одеяла. 50 На первой панели лоскутного одеяла написано:

Джемайма Блейки (рис. A) пришла не из обычных людей. Ее бабушка и бабушка выкупили свободу из рабства в Новом Орлеане.Бабушка Джемайма Блейки — ее тоже звали тетя Джемайма — пекла торты и устраивала прекрасные вечеринки для владельцев плантаций в Луизиане. И бабушка Блейки тоже была первоклассным портным. По памяти он мог сшить костюм по фигуре, как перчатку. Они были определенно умными людьми, эти Блейки. И Джемайма была такой же, как они: трудолюбивая и богобоязненная до самой своей смерти .

История продолжается о браке Джемаймы с Большим Руфусом, несмотря на то, что ее родители запрещали матчи, о ее переезде в Тампу, штат Флорида, и о работе домработницей до тех пор, пока в дом буквально не попадает молния, в результате чего Джемайма остается единственной выжившей. .Удар молнии дает наследство Джемайме и Большому Руфусу, которые вместе с детьми переезжают в Нью-Йорк, где открывают ресторан. Затем история крутится вокруг браков детей пары и дальнейшего движения, на этот раз в Новый Орлеан, прежде чем Джемайма и Большой Руфус погибнут в автокатастрофе, а их дети унаследуют. Талия Гума-Петерсон считала это и многие другие лоскутные одеяла Рингголда примерами рассказов, которые объединяют «элементы народных преданий и анекдотов с африканской и западноафриканской сказкой о дилеммах, традиции, которые Рингголд переняла из рассказов ее матери», признавая, что Рингголд истории, как правило, остаются открытыми, редко подтверждая окончательный вывод или предлагая единственный правильный результат. 51 Кто боится тети Джемаймы? Номер остается любопытной смесью фэнтезийного и морального смысла и начинает закономерность, которая проявляется во многих стеганых одеялах Рингголда.

Рисунок 3: Фейт Рингголд, Одеяло из рассказов об изнасиловании рабов , 1985, глубокая печать, 86 x 74 см, Ньюаркский музей, Нью-Джерси, изображение © и любезно предоставлено Фейт Рингголд

В Одеяло из рассказов об изнасиловании рабов (1985) «текст имеет приоритет над изображениями », 52 с композицией, основанной на широкоцентровом кресте из белой ткани с текстом, заполняющим все, кроме четырех центральных квадратов, которые вместо этого заполнены человеческими фигурами. 53 Написанный рассказ длиннее многих других примеров стеганых одеял Рингголда и рассказывает о матери и дочери, путешествующих на невольничьем корабле Cariolle, о самоубийстве матери после родов, утоплении насильника вместе с ней и о том, что Гума-Петерсон читает как еще один открытый финал. 54 Если Echoes of Harlem (1980) позволяло Рингголд пересказывать через изображения свои личные воспоминания о людях в определенный момент истории, Slave Rape Story Quilt (1985) гораздо больше полагается на письменное слово, чтобы передать повествование.

Рисунок 4: вид установки Фейт Рингголд The Purple Quilt (1986) в Джудит Лейбер: Создание нью-йоркской истории в Музее искусств и дизайна, Нью-Йорк, 2017, любезно предоставлено Музеем искусств и дизайна, фотография Дженна Баском

Год спустя, Пурпурное одеяло (1986) является необычным примером того, как Рингголд явно черпает вдохновение из другого повествования: получившего Пулитцеровскую премию романа Алисы Уокер Пурпурный цвет (1982) и его последующего фильма экранизация, режиссер Стивен Спилберг (1985).Главные герои нарисованы высокими продолговатыми блоками, а отрывки из текста Уокера включены в панели аналогичного формата справа и слева от средней части стеганого одеяла, обрамленные торсами других персонажей и окрашенными в галстуки блоками сверху и снизу. 55 Рингголд использует текст Уолкера — это стратегия, которая нечасто встречается в ее работах. Исключение составляет часть 2 из серии Jones Road (2010 г.), в которой она цитирует известных исторических личностей: Мартина Лютера Кинга, Харриет Табман и Соджорнер Трут.Гума-Петерсон пишет о The Purple Quilt : «В этой работе, как и в Slave Rape Story Quilt , Рингголд заявляет о повествовании о тройном черном женском голосе (ее собственном, Элис Уокер и Сели [главный герой Уокер] ) интерпретировать женский опыт через форму искусства (Одеяло), которое часто считается коллективным, анонимным творением ». 56

Сама Уокер резко подняла вопрос анонимности афро-американских лоскутных одеял:

в Смитсоновском институте в Вашингтоне, округ Колумбия.С., там висит одеяло, не похожее ни на одно другое в мире […] Под этим одеялом я увидел записку, в которой говорится, что оно было сделано «анонимной чернокожей женщиной из Алабамы сто лет назад». Если бы мы смогли найти эту «анонимную» чернокожую женщину из Алабамы, она оказалась бы одной из наших бабушек — художницей, оставившей свой след в тех материалах, которые она могла себе позволить, и в единственном средстве, которое позволяло ей ее положение в обществе. используйте . 57

Шоуолтер справедливо отмечает, что «пирсинг и квилтинг не были анонимными искусствами, хотя имена и личности мастеров лоскутного шитья часто замалчивались историей современного искусства и музейным кураторством. 58 Но и Уокер, и крючки предостерегают от забвения обстоятельств исторических традиций лоскутного шитья в афроамериканской культуре.

Рисунок 5: Фейт Рингголд, Женщина на мосту # 1 из 5: Тар-Бич , 1988, холст, акрил 74 x 69 см, Музей Соломона Р. Гуггенхайма, Нью-Йорк, изображение © и любезно предоставлено Фейт Рингголд

Шесть лет спустя Purple Quilt отдает дань уважения авторскому голосу Уокера, собственные письменные и стеганые голоса Рингголда объединяются в Tar Beach (1988), нарисованном сюжетном лоскутном одеяле, которое сейчас хранится в Соломон Р.Коллекция Музея Гуггенхайма и первая из пяти коллекций под названием Женщины на мосту и детская книга 59 с тем же названием (1991). 60 Рассказанная голосом восьмилетней Кэсси Луиз Лайтфут, история Рингголд напоминает о ее детском опыте летних вечеров, спасающихся от жары на (просмоленной) крыше многоквартирного дома, где она жила в детстве. Представляя свою перспективу высоко в небе, смотрящую вниз на крышу и близлежащий мост Джорджа Вашингтона, рассказчик объясняет: «Сон на пляже Тар был волшебным.Лежание на крыше в ночи, окруженное звездами и небоскребами, заставляло меня чувствовать себя богатым, как будто я владел всем, что мог видеть. Мост был моим самым ценным достоянием ». 61

Далее рассказывается, что дата открытия моста совпадает с датой рождения Рингголд, строительные работы ее отца на мосту, а затем его опыт безработицы и исключения из профсоюза, «потому что дедушка не был член.» 62 Панели с рукописным текстом появляются вверху и внизу лоскутного одеяла, а книжная версия сопровождается дополнительными иллюстрациями. 63 Расизм не исключается из повествования, но Рингголд нашел дидактический выход через формат детской литературы, которая объединяет элементы автобиографии и художественной литературы.

В то время как стратегия Рингголда по публикации на ткани началась с работ, выполненных в 1980-х годах, Мишель Уоллес отмечает, что публикация Tar Beach (1991), за которой последовали ее мемуары Мы пролетели над мостом (1995) «сняла срочность, которая поначалу она хотела включить свои рассказы в одеяла ». 64 Тем не менее, она отказалась от художественного подхода. Coming to Jones Road Part 1 (1999-2000) и Part 2 (2009-2010), серия — даже называемая tankas в некоторых названиях работ части 2 — акрила на холсте в обрамлении ткани границы включают текст, взятый у известных исторических личностей, таких как Мартин Лютер Кинг-младший, Харриет Табман и Соджорнер Трут, которые создают фоновую рамку вокруг лица каждого человека. В более поздних работах, особенно в ее серии French Connection , по-прежнему присутствуют литературные и художественные отсылки. 65

Ringgold продолжает создавать картины и текстиль с политическим содержанием. Акриловые холсты American Collection # 1: We Came to America (1997) 66 и The American Collection # 6: The Flag is Bleeding # 2 (1997) изображают, соответственно, океан черных тел, плывущих к Черная статуя Свободы с дредами и американский флаг, капающий красной кровью и частично скрывающий чернокожую женщину, которая стоит с двумя детьми, держась за ее талию.Сегодня, когда ей почти девяносто лет, она продолжает работать, заработав статус признанной и знаменитой артистки. Но пересечение расы и пола, в случае со стереотипными предположениями Рингголд, которые сначала привели ее к публикации на ткани, втягивают ее работу в сложные отношения с ремеслом. Атер, чей раздел о Ringgold в String, Felt, Thread озаглавлен «Художник, который работает в Quilt Medium», подтверждает: критика границ и иерархий мира искусства, которые повлияли на нее как на афроамериканскую художницу.С другой стороны, ее защитное отношение к названию «живопись» для этих работ, когда ценность их гибридности ставилась под сомнение, также свидетельствует о столь же значительных инвестициях в успех в том же мире искусства. С точки зрения Рингголда, цель преодоления или разрушения границ между искусством и ремеслом, имеющими важное значение для формального и политического значения данного произведения, может быть достигнута только во имя искусства . 67

Первоначальное стремление Рингголд публиковаться на ткани было вызвано желанием раскрыть жизнь большего подчинения, чем она пережила.Текстиль предоставил полезный и, в конечном итоге, успешный путь в издательский мир, где она хотела, чтобы ее голос был услышан. Эффективность того значения, которое она придавала своим одеялам, воспринимаемым как искусство, а не ремесло, сегодня гораздо менее очевидна. Вместо этого повествовательные лоскутные одеяла Рингголд знаменуют определенный этап в ее карьере — возможно, не меньший интерес из-за того, что и к чему ведет, чем из того, как они стоят особняком.

Рисунок 6: вид инсталляции Serpentine Gallery, Лондон: (слева) Фейт Рингголд, American Collection # 1: We Came to America , 1997, холст, акрил, 74.5 x 79,5 дюйма, 189,2 x 201,9 см, любезно предоставлено Академией изящных искусств Пенсильвании, Филадельфия, Коллекция Art by Women, Дар Линды Ли Альтер; (справа) The American Collection # 6: The Flag is Bleeding # 2 , 1997, холст, акрил с раскрашенной и разрезанной рамкой, 76 x 79,5 дюйма, 193 x 201,9 см, частная коллекция, любезно предоставлено галереей Pippy Houldsworth, Лондон

UX Исследования, обучение и консультирование

В то время как визуальный дизайн веб-сайта — это то, как ваша компания выглядит в Интернете, текст сайта — это то, как ваша компания звучит в Интернете.Тон голоса и качественное содержание имеют решающее значение для общения в Интернете. Тем не менее, лучший копирайтинг ни к чему, если пользователи не читают текст.

Как и в других областях взаимодействия с пользователем, контент должен выдерживать анализ затрат и выгод со стороны пользователей:

  • Стоимость: сколько хлопот и боли мне приходится терпеть на этом сайте?
  • Преимущества: что это для меня, что я получу, если прочту эту информацию?

Определенно предоставить преимущества пользователям.Зачем еще есть сайт? Но вам также необходимо уменьшить препятствия для его использования (т. Е. Снизить стоимость). В случае онлайн-копии препятствия для использования делятся на 3 категории: разборчивость, удобочитаемость и понимание, каждая из которых определяется и обсуждается ниже.

Разборчивость

Определение: Разборчивость — это самый низкий уровень удобства использования контента: это то, могут ли люди видеть, различать и узнавать символы и слова в вашем тексте. Таким образом, разборчивость в основном определяется визуальным дизайном, в частности типографикой.

Основные рекомендации по обеспечению удобочитаемости:

  • Используйте достаточно крупный шрифт по умолчанию размером и разрешите пользователям изменять размер шрифта. Крошечный текст обрекает на читаемость — и помните, что то, что считается «крошечным», у разных людей различается в зависимости от их остроты зрения, которая, к сожалению, с возрастом снижается. Старым пользователям нужен более крупный текст, но даже молодые пользователи ценят то, что им не нужно щуриться, чтобы прочитать текст. (В частности, подростки часто имеют ужасную осанку и не сидят прямо перед компьютером.)
  • Имеют высокий контраст между персонажами и фоном. Предпочтительно использовать простой фон вместо насыщенного или текстурированного, поскольку последний мешает распознаванию мелких деталей в формах букв.
  • Используйте чистый шрифт . На современных мониторах с высоким разрешением шрифт с засечками подходит, но шрифты странной формы (например, имитирующие почерк или готический стиль) ухудшают читаемость.

Проверка разборчивости

Если вы будете следовать приведенным выше рекомендациям, а также другим лучшим практикам для чистой типографики, вам вряд ли понадобятся специальные тесты на разборчивость.При регулярном пользовательском тестировании вы можете не упустить случаи, когда пользователи наклоняются к экрану или говорят что-то вроде «здесь трудно разобрать текст». Если вы заметите такое поведение или комментарии, вы можете беспокоиться и провести специальные тесты на разборчивость, но в остальном вы, вероятно, в безопасности.

Основной способ проверки разборчивости — это измерение скорости чтения слов в минуту для выборки пользователей, читающих простой текст. Поскольку люди читают с разной скоростью, это лучше всего проводить в рамках предметного теста, когда одних и тех же участников теста тестируют несколько систем.Если пользователи в среднем, скажем, на 20% медленнее читают ваш дизайн, чем читают эталонный дизайн, то вы знаете, что ваш сайт плохо читается. (См. Наш курс по измерению пользовательского опыта, чтобы узнать больше о дизайнах внутрипредметных и межпредметных исследований.)

В качестве примера посмотрите тест, который мы провели в 2010 году, сравнивая скорость чтения на iPad, Kindle и печатных книгах. (Но не стоит использовать старые результаты, чтобы решить, какой планшет покупать сегодня, поскольку оба продукта теперь имеют более качественные экраны и лучшую читаемость.)

Читаемость

Определение: Читаемость измеряет сложность слов и структуры предложения в фрагменте контента. Предположение, лежащее в основе этой метрики, заключается в том, что сложные предложения сложнее разбирать и читать, чем более простые. Обычно указывается как уровень чтения (указывается как годы формального образования), необходимый для легкого чтения текста. Например, уровень чтения 12 -го -го класса означает, что кто-то с хорошим аттестатом о среднем образовании сможет читать текст без затруднений.

Основные рекомендации по обеспечению читаемости:

  • Используйте простые слова, чем короче, тем лучше. Избегайте вымышленных слов и словосочетаний.
  • Используйте короткие предложения. Избегайте замысловатых структур предложений, особенно сложных предложений с множеством придаточных предложений и союзов, которые создают нагрузку на кратковременную память пользователей, что является заведомо слабым местом. (Последнее предложение уже немного подталкивает 🙂
  • В основном пишите активным голосом.(Пассивный голос может использоваться в редких случаях, когда он позволяет предварительно загрузить ключевые термины.)
  • Стремитесь к уровню чтения 8 -го -го, если нацелены на широкую потребительскую аудиторию.
  • Если вы пишете для образованной или специализированной аудитории B2B, все равно ориентируйтесь на уровень чтения, который на несколько ступеней ниже уровня формального образования аудитории. 12 th — уровень чтения часто является хорошей целью для облегчения чтения текста для читателей с высшим образованием. (У статьи, которую вы сейчас читаете, уровень чтения 11 -го -го, и я надеюсь, вы сочтете ее удобочитаемой.)
  • Помните, что письмо на уровне чтения N th — другое дело, чем письмо для учеников, которые в настоящее время посещают школу в этом классе. Существуют специальные рекомендации по дизайну, ориентированные на маленьких детей, подростков и миллениалов, и это не то, что мы хотим от обычных веб-сайтов для взрослых пользователей. Нам просто нужны слова и предложения, соответствующие этому уровню образовательных достижений, но написанные зрелым тоном.

Проверка читаемости

Читаемость обычно оценивается компьютером.В Интернете есть много калькуляторов удобочитаемости, и в Microsoft Word встроена общая формула: в Word 2013 уровень чтения Флеша-Кинкейда доступен в разделе Review> Spelling & Grammar . (В некоторых версиях Word статистику удобочитаемости необходимо сначала включить в меню Файл> Параметры> Проверка .)

На самом деле мы немного предпочитаем другую формулу удобочитаемости, называемую оценкой Фрая, но на самом деле не имеет значения, какую формулу вы используете.Хотя существует множество формул удобочитаемости, все они в основном ориентированы на длину слов и длину предложений. Более длинные слова обычно реже встречаются в языке, а более длинные предложения обычно сложнее разбирать, поэтому эти типы показателей имеют смысл. Но помните, что эти подсчеты являются лишь приблизительной оценкой того, что действительно имеет значение: насколько трудно вашим читателям разобраться в словах и предложениях, которые вы используете.

Уровень чтения в зависимости от количества лет обучения также является приблизительным.Когда мы говорим, что 12-й уровень чтения соответствует аттестату средней школы, это предполагает, что выпускник средней школы был достаточно прилежным, чтобы изучить и усвоить все материалы и предметы на уровне своего класса. Многие люди заканчивают среднюю школу, несмотря на плохие навыки чтения, и им будет сложно читать текст, набравший 12 -й уровень чтения .

Понимание

Определение: Понимание измеряет, может ли пользователь понять предполагаемое значение текста и может ли он сделать правильные выводы из текста.В случае учебного или ориентированного на действия контента мы также хотим, чтобы пользователи могли выполнять намеченные действия после прочтения текста.

Основные правила понимания:

  • Использовать ориентированный на пользователя язык; термины, знакомые вашей аудитории, облегчают понимание.
  • Если нацелена на специализированную аудиторию (например, для B2B, научного сайта или сайта энтузиастов / фанатов / любителей), используйте специализированную терминологию в этой области, даже если некоторые из этих слов являются трудными для широкой потребительской аудитории, и, таким образом, снизят ваш оценка читабельности.
  • Используйте стиль письма в виде перевернутой пирамиды : начните с заключения или обзора основной мысли. Люди лучше относятся к второстепенным моментам, когда они уже знают основы.
  • Минимизируйте когнитивную нагрузку, опираясь на существующие ментальные модели и уменьшая потребность пользователей в запоминании вещей от одной части текста к другой.
  • Рисунки или концептуальные диаграммы иногда могут объяснить вещи лучше, чем стопки слов.
  • Будьте краткими.Если вы говорите меньше, люди с большей вероятностью попытаются понять, что вы говорите.
  • Если для вас важны мобильные пользователи, сделайте еще короче и упростите еще больше. Меньшее окно просмотра ухудшает понимание, потому что пользователи могут сразу увидеть небольшой контекст и не могут легко вернуться к ранее прочитанной информации.

Тестирование понимания

Основным способом проверки понимания веб-контента является стандартное пользовательское тестирование, иногда с небольшими изменениями для тестирования контента.Единственный способ узнать, делают ли люди правильные выводы из нашей копии, — это заставить их выполнять реалистичные задачи с сайтом и наблюдать, как они интерпретируют информацию сайта, когда они с ней сталкиваются.

После того, как участники исследования выполнили свои тестовые задания, мы можем дополнительно измерить их понимание, предложив им различные формы экзаменов. Они могут варьироваться от простого теста памяти до более сложных вопросов, которые действительно проверяют понимание материала людьми. В одном тематическом исследовании мы переписали веб-страницы о сложном продукте B2B, и после использования новой версии сайта пользователи запомнили 65% характеристик продукта, которые мы тестировали — почти вдвое больше, чем 33% аналогичных материалов запомнили тестовые пользователи после использования оригинального контента.

Вы также можете запустить тест Cloze для отдельных частей контента, которые особенно важны или вызвали проблемы при пользовательском тестировании. Тест Cloze дает хорошие результаты, поэтому вы можете повторно запустить тест после перезаписи, чтобы увидеть, достаточно ли улучшился текст.

Удобство использования контента: помимо разборчивости, удобочитаемости и понимания

Можно подумать, что трех критериев, обсуждаемых в этой статье, будет достаточно для обеспечения качественного веб-контента. Не так. Их необходимо, но недостаточно .

Тот факт, что люди могут читать и понимать ваш контент, не означает, что они будут это делать. При среднем посещении веб-страницы пользователи читают только 28% слов. В Интернете так много информации, что люди обычно сканируют, а не читают.

Тем не менее, пользователи иногда действительно читают веб-контент, особенно когда он включает интересующую их информацию. Ключевой момент — быстро захватить пользователей и заинтересовать их до того, как они решат уйти, что они часто делают сразу же.Заголовки особенно важны для быстрого общения, а первые несколько слов даже более важны, учитывая склонность пользователей сканировать.

Таким образом, помимо хорошей разборчивости, удобочитаемости и понимания, сделайте следующее:

  • Напишите, как пользователи читают на веб-сайтах: четкие заголовки, удобочитаемый макет.
  • Сосредоточьтесь на информации, интересной для пользователей, а не на том, что вы хотите продвигать.
  • Немедленно сообщите в верхней части страницы, что ваш контент действительно интересен и полезен для пользователей.

Наш дневной курс по написанию убедительной цифровой копии содержит практическое освещение поднятых здесь вопросов.

Использование Python для анализа данных электронных таблиц

Крупные организации и предприятия часто хранят данные в электронных таблицах и нуждаются в интерфейсе для ввода этих данных в свои веб-приложения. Общая идея состоит в том, чтобы загрузить файл, прочитать его содержимое и сохранить его либо в файлах, либо в базах данных, которые использует веб-приложение. Организациям также может потребоваться экспортировать данные из веб-приложения.Например, им может потребоваться экспортировать оценки всех учащихся в классе. Опять же, электронные таблицы — предпочтительный носитель.

В этом посте мы обсудим различные способы обработки этих файлов и их анализа для получения необходимой информации с помощью Python.

Краткое руководство по электронным таблицам

Перед анализом таблиц вы должны понять, как они устроены. Файл электронной таблицы — это набор листов, а каждый лист — это набор ячеек данных, помещенных в сетку, похожую на таблицу.На листе ячейка данных идентифицируется двумя значениями: номерами строки и столбца.

Например, на скриншоте выше электронная таблица содержит только один лист, «Sheet1». Ячейка «2A» соответствует второй строке и первому столбцу. Значение ячейки 2А — 1.

Хотя программы с графическим интерфейсом назначают буквы именам столбцов, при анализе данных мы начнем номера строк и столбцов с 0. Это означает, что ячейка 2A будет соответствовать (1, 0), 4B — (1 , 3), от 3C до (2, 2) и так далее.

Настройка среды Python

Мы будем использовать Python 3 для чтения и записи электронных таблиц. Чтобы читать и писать файлы XLSX, вам необходимо установить модуль Pandas. Вы можете сделать это через один из установщиков Python: pip или easy_install . Pandas использует модуль openpyxl для чтения новых файлов электронных таблиц (.xlsx) и модули xlrd для чтения старых электронных таблиц (файлы .xls). Оба эти openpyxl и xlrd устанавливаются как зависимости при установке Pandas:

  pip3 установить панды
  

Для чтения и записи файлов CSV необходим модуль csv , который предустановлен вместе с Python.Вы также можете читать файлы CSV через Pandas.

Чтение электронных таблиц

Если у вас есть файл и вы хотите проанализировать содержащиеся в нем данные, вам необходимо выполнить следующее в таком порядке:

  1. импортировать модуль pandas
  2. открыть файл электронной таблицы (или книгу)
  3. выберите лист
  4. извлекает значения определенных ячеек данных

Открыть файл электронной таблицы

Давайте сначала откроем файл на Python. Чтобы продолжить, вы можете использовать следующий образец электронной таблицы, любезно предоставленный Learning Container:

  импортировать панд как pd
книга = pd.read_excel ('образец-xlsx-файл-для-тестирования.xlsx')
workbook.head ()
  
Сегмент Страна Товар Дисконтный браслет Продано квартир Производственная цена Цена продажи Валовые продажи Скидки Продажа КОГС Прибыль Дата Номер месяца Название месяца Год
0 Правительство Канада Carretera Нет 1618.5 3 20 32370,0 0,0 32370,0 16185,0 16185,0 01.01.2014 1 Январь 2014
1 Правительство Германия Carretera Нет 1321,0 3 20 26420,0 0,0 26420,0 13210,0 13210.0 01.01.2014 1 Январь 2014
2 Средний рынок Франция Carretera Нет 2178,0 3 15 32670,0 0,0 32670,0 21780,0 10890,0 2014-06-01 6 июнь 2014
3 Средний рынок Германия Carretera Нет 888.0 3 15 13320,0 0,0 13320,0 8880,0 4440,0 2014-06-01 6 июнь 2014
4 Средний рынок Мексика Carretera Нет 2470,0 3 15 37050,0 0,0 37050,0 24700,0 12350,0 2014-06-01 6 июнь 2014

Pandas читает электронную таблицу как таблицу и сохраняет ее как фрейм данных Pandas.

Если ваш файл содержит символы, отличные от ASCII, вы должны открыть его в формате Unicode следующим образом:

  импорт систем
рабочая книга = pd.read_excel ('образец-xlsx-файл-для-тестирования.xlsx', кодировка = sys.getfilesystemencoding ())
  

Если ваша электронная таблица очень большая, вы можете добавить аргумент use_cols , который загружает только определенные столбцы в фрейм данных. Например, следующий аргумент будет читать только первые пять столбцов:

  рабочая тетрадь = pd.read_excel ('~ / Рабочий стол / import-export-data.xlsx', usecols = 'A: E')
workbook.head ()
  
Сегмент Страна Товар Дисконтный браслет Продано квартир
0 Правительство Канада Carretera Нет 1618,5
1 Правительство Германия Carretera Нет 1321.0
2 Средний рынок Франция Carretera Нет 2178,0
3 Средний рынок Германия Carretera Нет 888,0
4 Средний рынок Мексика Carretera Нет 2470,0

Кроме того, вы можете использовать аргументы nrows и skiprows , чтобы читать только определенное количество строк или игнорировать определенное количество строк в начале, соответственно.

Открытие определенного листа

Вы можете выбрать определенный лист из своей электронной таблицы с помощью аргумента имя_листа . По умолчанию функция read_excel () анализирует первый лист в файле. Вы можете указать имя листа в виде строки или индекс листа (начиная с 0):

 
рабочий лист = pd.read_excel ('образец-xlsx-файл-для-тестирования.xlsx', имя_листа = 'Лист1')
  
 
рабочий лист = pd.read_excel ('образец-xlsx-файл-для-тестирования.xlsx ', имя_листа = 0)
  

Вы также можете выбрать количество листов для хранения в виде фреймов данных Pandas, передав список с аргументом имя_листа :

 
worksheets = pd.read_excel ('~ / Desktop / import-export-data.xlsx', sheet_name = [0, 1, 'Лист 3'])
  

Получение данных из ячеек

После того, как вы выбрали рабочий лист во фрейм данных, вы можете извлечь значение определенной ячейки данных, запросив в фреймворке Pandas:

  импортировать панд как pd
книга = pd.read_excel ('образец-xlsx-файл-для-тестирования.xlsx')


печать (рабочая книга ['Продукт']. iloc [0])

=> Карретера
  

Метод .iloc () помогает искать значение на основе положения индекса. В приведенном выше коде .iloc () ищет значение в нулевой позиции индекса. Точно так же вы можете искать значение, используя метку с помощью метода .loc (). Например, если вы передадите аргумент 0 методу .loc () , он будет искать метку 0 в индексе:

  отпечаток (рабочая тетрадь [«Продукт»].loc [0])

=> Карретера
  

Вы можете запросить свой набор данных после его загрузки в фрейм данных с помощью встроенных функций в Pandas. Вот статья об изучении значений вашего фрейма данных Pandas.

Создание электронных таблиц

Рабочий процесс для создания рабочих листов аналогичен описанному в предыдущем разделе.

  1. импортировать модуль pandas
  2. сохранить данные в книгу
  3. создать лист в книге
  4. добавить стиль к ячейкам в книге

Создать новый файл

Чтобы создать новый файл, нам сначала нужен фрейм данных.Давайте воссоздадим демонстрационный лист из верхней части статьи:

  импортировать панд как pd

name = ['Джон', 'Мэри', 'Шерлок']
возраст = [11, 12, 13]
df = pd.DataFrame ({'Имя': имя, 'Возраст': возраст})
df.index.name = 'ID'
  

Затем вы можете создать новый файл электронной таблицы, вызвав функцию to_excel () в фрейме данных, указав имя файла, который он должен сохранить как:

  df.to_excel ('my_file.xlsx')
  

Вы также можете открыть тот же файл с помощью функции read_excel () .

Добавление листов

Вы можете сохранить фрейм данных как определенный лист в книге, используя аргумент имя_листа . Значение этого аргумента по умолчанию — Sheet1 :

  df.to_excel ('my_file.xlsx', sheet_name = 'Мой лист')
  

Дополнительные параметры при сохранении таблицы

Вы можете использовать класс ExcelWriter, чтобы получить больше возможностей при сохранении в электронную таблицу. Если вы хотите сохранить несколько фреймов данных в одном файле, вы можете использовать следующий синтаксис:

  импортировать панд как pd

книга = pd.read_excel ('мой_файл.xlsx')


workbook_2 = workbook.copy ()

с pd.ExcelWriter ('my_file_1.xlsx') в качестве писателя:
    workbook.to_excel (писатель, sheet_name = 'Sheet1')
    workbook_2.to_excel (писатель, sheet_name = 'Sheet2')
  

Чтобы добавить фрейм данных в существующую электронную таблицу, используйте аргумент mode . Обратите внимание, что режим добавления поддерживается только при указании движка openpyxl :

  с pd.ExcelWriter ('my_file_1.xlsx', engine = "openpyxl", mode = 'a') в качестве писателя:
    workbook_2.to_excel (писатель, sheet_name = 'Sheet3'
  

Кроме того, используйте date_format и datetime_format , чтобы установить значения для значений даты и времени:

  с pd.ExcelWriter ('my_file.xlsx',
  date_format = 'ГГГГ-ММ-ДД',
    datetime_format = 'ГГГГ-ММ-ДД ЧЧ: ММ: СС') как писатель:
  workbook.to_excel (писатель)
  

Чтение таблиц прежних версий (.xls)

Вы можете читать старые электронные таблицы с расширением .xls , используя тот же синтаксис в Pandas:

  рабочая тетрадь = pd.read_excel ('имя_файла.xls')
  

В то время как вы использовали ту же функцию read_excel () , Pandas использует механизм xlrd для ее чтения. Вы можете читать и писать устаревшие электронные таблицы, используя тот же синтаксис, который мы обсуждали ранее в этом руководстве.

Краткое описание файлов CSV

CSV означает «значения, разделенные запятыми» (или иногда разделенные символами, если в качестве разделителя используется какой-либо символ, отличный от запятой), и имя довольно понятно.Типичный CSV-файл выглядит следующим образом:

  «ID», «Имя», «Возраст»
«1», «Джон», «11»
'2', 'Мэри', '12'
«3», «Шерлок», «13»
  

Вы можете конвертировать электронные таблицы в файлы CSV, чтобы упростить анализ. Файлы CSV можно легко проанализировать с помощью модуля csv в Python в дополнение к Pandas:

  workbook = pd.read_csv ('my_file_name.csv')
  

Заключение

Как я упоминал ранее, создание и анализ таблиц неизбежны, когда вы работаете с огромными веб-приложениями.Таким образом, знакомство с библиотеками синтаксического анализа может помочь вам только тогда, когда в этом возникнет необходимость.

Какой язык сценариев вы используете для работы с электронными таблицами? Есть ли у Python какие-либо другие библиотеки для этой цели, которые вы предпочитаете? Не стесняйтесь писать мне в Твиттер.

10 советов по YAML для людей, которые ненавидят YAML

Существует множество форматов файлов конфигурации: список значений, пары ключей и значений, файлы INI, YAML, JSON, XML и многие другие. Из них YAML иногда называют особенно сложным для обработки по нескольким различным причинам.Хотя его способность отражать иерархические ценности значительна, а его минимализм может быть освежающим для некоторых, его Python-подобная зависимость от синтаксических пробелов может расстраивать.

Однако мир с открытым исходным кодом достаточно разнообразен и гибок, чтобы никому не приходилось страдать от абразивных технологий, поэтому, если вы ненавидите YAML, вот 10 вещей, которые вы можете (и должны!) Сделать, чтобы сделать его терпимым. Начиная с нуля, как и положено любому разумному индексу.

0. Заставьте ваш редактор делать всю работу

Какой бы текстовый редактор вы ни использовали, вероятно, есть плагины, упрощающие работу с синтаксисом.Если вы не используете плагин YAML для своего редактора, найдите его и установите. Усилия, которые вы потратите на поиск плагина и его настройку по мере необходимости, окупятся в десять раз при следующем редактировании YAML.

Например, редактор Atom по умолчанию поставляется с режимом YAML, и хотя GNU Emacs поставляется с минимальной поддержкой, вы можете добавить дополнительные пакеты, такие как yaml-mode, чтобы помочь.

Emacs в режиме YAML и пробелов.

Если в вашем любимом текстовом редакторе отсутствует режим YAML, вы можете решить некоторые из своих проблем с помощью небольших изменений конфигурации.Например, текстовый редактор по умолчанию для рабочего стола GNOME, Gedit, не имеет доступного режима YAML, но по умолчанию обеспечивает подсветку синтаксиса YAML и имеет настраиваемую ширину вкладки:

Настройка ширины вкладки и типа в Gedit.

С помощью пакета плагина drawspaces Gedit вы можете сделать пустое пространство видимым в виде ведущих точек, снимая любые вопросы об уровнях отступа.

Найдите время, чтобы изучить свой любимый текстовый редактор.Узнайте, что делает редактор или его сообщество, чтобы упростить YAML, и используйте эти функции в своей работе. Вы не пожалеете.

1. Используйте линтер

В идеале языки программирования и языки разметки используют предсказуемый синтаксис. Компьютеры, как правило, преуспевают в предсказуемости, поэтому концепция линтера была изобретена в 1978 году. Если вы не используете линтер для YAML, то пора принять эту 40-летнюю традицию и использовать yamllint .

Вы можете установить yamllint в Linux с помощью диспетчера пакетов вашего дистрибутива.Например, в Red Hat Enterprise Linux 8 или Fedora:

  $ sudo dnf установить yamllint
  

Вызвать yamllint так же просто, как сказать ему проверить файл. Вот пример ответа yamllint на файл YAML, содержащий ошибку:

  $ yamllint errorprone.yaml
errorprone.yaml
Ошибка синтаксиса 23:10: здесь недопустимы значения сопоставления
23:11 ошибка конечных пробелов (конечные пробелы)
  

Это не отметка времени слева.Это номер строки и столбца ошибки. Вы можете понять, а можете и не понять, о какой ошибке идет речь, но теперь вы знаете, где находится ошибка. Если еще раз взглянуть на место, то природа ошибки часто становится очевидной. Об успехе пугающе тихо, поэтому, если вам нужна обратная связь, основанная на успехе линта, вы можете добавить условную вторую команду с двойным амперсандом ( && ). В оболочке POSIX && завершается ошибкой, если команда возвращает что-нибудь , но не 0, поэтому в случае успеха ваша команда echo проясняет это.Эта тактика несколько поверхностна, но некоторые пользователи предпочитают уверенность в правильности выполнения команды, а не молчаливую ошибку. Вот пример:

  $ yamllint perfect.yaml && echo "ОК"
В ПОРЯДКЕ
  

Причина, по которой yamllint молчит при успешном завершении, заключается в том, что он возвращает 0 ошибок, когда ошибок нет.

2. Пишите на Python, а не на YAML

Если вы действительно ненавидите YAML, перестаньте писать на YAML, по крайней мере, в буквальном смысле.Возможно, вы застряли с YAML, потому что это единственный формат, который принимает приложение, но если единственное требование — закончить в YAML, тогда работайте в другом, а затем конвертируйте. Python вместе с превосходной библиотекой pyyaml ​​упрощает эту задачу, и у вас есть два метода на выбор: самопреобразование или сценарий.

Самоконвертация

В методе самопреобразования ваши файлы данных также являются сценариями Python, которые создают YAML. Это лучше всего подходит для небольших наборов данных. Просто запишите данные JSON в переменную Python, добавьте к ней оператор import и завершите файл простым трехстрочным оператором вывода.

  #! / Usr / bin / python3
импортировать ямл

d = {
"глоссарий": {
  "title": "пример глоссария",
  "GlossDiv": {
"title": "S",
"GlossList": {
"GlossEntry": {
«ID»: «SGML»,
«SortAs»: «SGML»,
"GlossTerm": "Стандартный обобщенный язык разметки",
«Акроним»: «SGML»,
«Аббревиатура»: «ISO 8879: 1986»,
"GlossDef": {
"para": "Язык мета-разметки, используемый для создания языков разметки, таких как DocBook.",
"GlossSeeAlso": ["GML", "XML"]
},
"GlossSee": "разметка"
}
}
}
  }
}

f = open ('output.ямл ',' ш ')
f.write (yaml.dump (d))
f.close
  

Запустите файл с помощью Python, чтобы создать файл с именем output.yaml file.

  $ python3 ./example.json
$ cat output.yaml
глоссарий:
  GlossDiv:
GlossList:
GlossEntry:
Сокращение: ISO 8879: 1986.
Акроним: SGML
GlossDef:
GlossSeeAlso: [GML, XML]
para: язык мета-разметки, используемый для создания языков разметки, таких как DocBook.
GlossSee: разметка
GlossTerm: стандартный обобщенный язык разметки
ID: SGML
Сорта: SGML
название: S
  название: пример глоссария
  

Этот вывод является совершенно правильным YAML, хотя yamllint действительно выдает предупреждение о том, что файл не имеет префикса --- , который вы можете настроить либо в скрипте Python, либо вручную.

Преобразование по сценарию

В этом методе вы пишете в JSON, а затем запускаете скрипт преобразования Python для создания YAML. Это масштабируется лучше, чем самопреобразование, потому что оно отделяет преобразователь от данных.

Создайте файл JSON и сохраните его как example.json . Вот пример с json.org:

  {
"глоссарий": {
"title": "пример глоссария",
"GlossDiv": {
"title": "S",
"GlossList": {
"GlossEntry": {
«ID»: «SGML»,
«SortAs»: «SGML»,
"GlossTerm": "Стандартный обобщенный язык разметки",
«Акроним»: «SGML»,
«Аббревиатура»: «ISO 8879: 1986»,
"GlossDef": {
«para»: «Язык мета-разметки, используемый для создания языков разметки, таких как DocBook.",
"GlossSeeAlso": ["GML", "XML"]
},
"GlossSee": "разметка"
}
}
}
}
}
  

Создайте простой конвертер и сохраните его как json2yaml.py . Этот сценарий импортирует модули Python YAML и JSON, загружает файл JSON, определенный пользователем, выполняет преобразование и затем записывает данные в файл output.yaml .

  #! / Usr / bin / python3
импортировать ямл
import sys
импортировать json

OUT = open ('output.yaml', 'ш')
IN = открытый (sys.argv [1], 'r')

JSON = json.нагрузка (IN)
IN.close ()
yaml.dump (JSON, ВЫХОД)
OUT.close ()
  

Сохраните этот сценарий в системном пути и выполните при необходимости:

  $ ~ / bin / json2yaml.py example.json  

3. Анализировать рано, анализировать часто

Иногда помогает взглянуть на проблему под другим углом. Если ваша проблема — YAML, и вам трудно визуализировать отношения данных, вы можете найти полезным временно реструктурировать эти данные во что-то, с чем вы более знакомы.

Если вам удобнее работать со списками в стиле словаря или, например, с JSON, вы можете преобразовать YAML в JSON двумя командами, используя интерактивную оболочку Python. Предположим, ваш файл YAML называется mydata.yaml .

  $ python3
>>> f = open ('mydata.yaml', 'r')
>>> yaml.load (f)
{'document': 34843, 'date': datetime.date (2019, 5, 23), 'bill-to': {'given': 'Seth', 'family': 'Kenlon', 'address': { 'street': '51b Mornington Road \ n', 'city': 'Brooklyn', 'state': 'Wellington', 'postal': 6021, 'country': 'NZ'}}, 'words': 938, 'comments': 'Хорошая статья.Могло быть лучше.'}
  

Есть много других примеров, и существует множество онлайн-конвертеров и локальных парсеров, поэтому не бойтесь переформатировать данные, когда они начинают больше походить на список для стирки, чем на разметку.

4. Прочтите спецификацию

После того, как я какое-то время отлучился от YAML и обнаружил, что снова использую его, я сразу же возвращаюсь на yaml.org, чтобы перечитать спецификацию. Если вы никогда не читали спецификацию YAML и находите YAML сбивающим с толку, взгляд на спецификацию может дать разъяснение, о котором вы даже не подозревали.Спецификацию на удивление легко читать, а требования к действующему YAML прописаны с множеством примеров в главе 6.

5. Псевдоконфигурация

Перед тем, как я начал писать свою книгу «Разработка игр на Raspberry Pi», Apress, 2019, издатель попросил меня дать набросок. Казалось бы, набросок будет легким. По определению, это просто названия глав и разделов без реального содержания. И все же из 300 опубликованных страниц сложнее всего было написать первоначальный план.

YAML может быть таким же. Вы можете иметь представление о данных, которые необходимо записать, но это не значит, что вы полностью понимаете, как все это связано. Поэтому, прежде чем вы сядете писать YAML, попробуйте вместо этого выполнить псевдоконфигурацию.

Псевдоконфигурация похожа на псевдокод. Вам не нужно беспокоиться о структуре или отступах, родительско-дочерних отношениях, наследовании или вложенности. Вы просто создаете итерации данных в том виде, в котором вы их понимаете в своей голове.

Псевдоконфиг.

Когда вы запишите свою псевдоконфигурацию на бумаге, изучите ее и преобразуйте свои результаты в действительный YAML.

6. Разрешите споры о пробелах и табуляциях

Хорошо, возможно, вы не сможете окончательно разрешить споры о пробелах и табуляциях, но вы должны, по крайней мере, разрешить споры внутри вашего проекта или организации. Независимо от того, решаете ли вы этот вопрос с помощью сценария пост-обработки sed , конфигурации текстового редактора или клятвы крови уважать результаты вашего линтера, любой в вашей команде, который касается проекта YAML, должен согласиться использовать пробелы (в соответствии с YAML спец).

Любой хороший текстовый редактор позволяет вам определять количество пробелов вместо символа табуляции, поэтому выбор не должен отрицательно повлиять на любителей клавиши Tab .

Табуляторы и пробелы, как вы, наверное, слишком хорошо знаете, по сути невидимы. И когда что-то скрывается из виду, это редко приходит в голову до самого конца, когда вы протестировали и устранили все «очевидные» проблемы. Час, потраченный на ошибочную вкладку или группу пробелов, — ваш сигнал к созданию политики для использования того или другого, а затем для разработки отказоустойчивой проверки на соответствие (например, ловушки Git для принудительного линтинга).

7. Меньше значит больше (или больше меньше)

Некоторым нравится писать YAML, чтобы подчеркнуть его структуру. Они энергично отступают, чтобы помочь себе визуализировать фрагменты данных. Это своего рода чит для имитации языков разметки с явными разделителями.

Вот хороший пример из документации Ansible:

  # Записи сотрудников
- Мартин:
        имя: Мартин Д'Влопер
        работа: Разработчик
        навыки и умения:
            - питон
            - перл
            - паскаль
- табита:
        имя: Табита Битум
        работа: Разработчик
        навыки и умения:
            - шепелявить
            - фортран
            - эрланг
  

Для некоторых пользователей этот подход является полезным способом разметки YAML-документа, в то время как другие пользователи упускают из виду структуру из-за отсутствия, казалось бы, ненужного пустого пространства.

Если вы владеете и поддерживаете документ YAML, то вы, , можете определить, что означает «отступ». Если блоки горизонтального белого пространства отвлекают вас, используйте минимальное количество белого пространства, требуемое спецификацией YAML. Например, тот же YAML из документации Ansible может быть представлен с меньшим количеством отступов без потери своей достоверности или значения:

  ---
- Мартин:
   имя: Мартин Д'Влопер
   работа: Разработчик
   навыки и умения:
   - питон
   - перл
   - паскаль
- табита:
   имя: Табита Битум
   работа: Разработчик
   навыки и умения:
   - шепелявить
   - фортран
   - эрланг
  

8.Сделать рецепт

Я большой поклонник повторного разведения знакомых, но иногда повторение просто порождает повторяющиеся глупые ошибки. К счастью, умная крестьянка испытала это явление еще в 396 году нашей эры (не проверяйте меня) и изобрела концепцию рецепта .

Если вы обнаружите, что снова и снова ошибаетесь в документе YAML, вы можете встроить рецепт или шаблон в файл YAML в виде закомментированного раздела. Когда вы добавляете раздел, скопируйте прокомментированный рецепт и перезапишите фиктивные данные своими новыми реальными данными.Например:

  ---
# - <обычное имя>:
# name: Данная фамилия
# работа: РАБОТА
#   навыки и умения:
# - ЯЗЫК
- Мартин:
  имя: Мартин Д'Влопер
  работа: Разработчик
  навыки и умения:
  - питон
  - перл
  - паскаль
- табита:
  имя: Табита Битум
  работа: Разработчик
  навыки и умения:
  - шепелявить
  - фортран
  - эрланг
  

9. Используйте что-нибудь другое

Я вообще фанат YAML, но иногда YAML — не ответ. Если вы не привязаны к YAML используемым приложением, вам может быть лучше подойдет какой-нибудь другой формат конфигурации.Иногда файлы конфигурации перерастают сами себя, и их лучше преобразовать в простые сценарии Lua или Python.

YAML — отличный инструмент, популярный среди пользователей за свой минимализм и простоту, но это не единственный инструмент в вашем наборе. Иногда лучше расстаться. Одним из преимуществ YAML является то, что библиотеки синтаксического анализа являются обычными, поэтому, пока вы предоставляете варианты миграции, ваши пользователи должны иметь возможность безболезненно адаптироваться.

Если YAML является обязательным требованием, помните об этих советах и ​​победите свою ненависть к YAML раз и навсегда!

Разбор файлов FASTA — Python для биологов 0.Документация 2.0

Формат файла FASTA

файлов FASTA используются для хранения данных последовательности. Его можно использовать как для нуклеотидных и белковые последовательности. В случае ДНК нуклеотиды представлены с использованием их однобуквенные сокращения: A, T, C и G. В случае белков амино кислоты представлены с использованием их однобуквенных сокращений, например А для аланина и W для триптофана.

Запись FASTA начинается с однострочного идентификатора. Эта строка идентификатора всегда начинается с символа «больше» > .

Ниже приведен пример записи ДНК FASTA, взятой из www.cbs.dtu.dk/services/NetGene2/fasta.php.

> HSBGPG Ген человека костного белка gla (BGP)
GGCAGATTCCCCCTAGACCCGCCCGCACCATGGTCAGGCATGCCCCTCCTCATCGCTGGGCACAGCCCAGAGGGT
ATAAACAGTGCTGGAGGCTGGCGGGGCAGGCCAGCTGAGTCCTGAGCAGCAGCCCAGCGCAGCCACCGAGACACC
ATGAGAGCCCTCACACTCCTCGCCCTATTGGCCCTGGCCGCACTTTGCATCGCTGGCCAGGCAGGTGAGTGCCCC
CACCTCCCCTCAGGCCGCATTGCAGTGGGGGCTGAGAGGAGGAAGCACCATGGCCCACCTCTTCTCACCCCTTTG
GCTGGCAGTCCCTTTGCAGTCTAACCACCTTGTTGCAGGCTCAATCCATTTGCCCCAGCTCTGCCCTTGCAGAGG
GAGAGGAGGGAAGAGCAAGCTGCCCGAGACGCAGGGGAAGGAGGATGAGGGCCCTGGGGATGAGCTGGGGTGAAC
CAGGCTCCCTTTCCTTTGCAGGTGCGAAGCCCAGCGGTGCAGAGTCCAGCAAAGGTGCAGGTATGAGGATGGACC
TGATGGGTTCCTGGACCCTCCCCTCTCACCCTGGTCCCTCAGTCTCATTCCCCCACTCCTGCCACCTCCTGTCTG
GCCATCAGGAAGGCCAGCCTGCTCCCCACCTGATCCTCCCAAACCCAGAGCCACCTGATGCCTGCCCCTCTGCTC
CACAGCCTTTGTGTCCAAGCAGGAGGGCAGCGAGGTAGTGAAGAGACCCAGGCGCTACCTGTATCAATGGCTGGG
GTGAGAGAAAAGGCAGAGCTGGGCCAAGGCCCTGCCTCTCCGGGATGGTCTGTGGGGGAGCTGCAGCAGGGAGTG
GCCTCTCTGGGTTGTGGTGGGGGTACAGGCAGCCTGCCCTGGTGGGCACCCTGGAGCCCCATGTGTAGGGAGAGG
AGGGATGGGCATTTTGCACGGGGGCTGATGCCACCACGTCGGGTGTCTCAGAGCCCCAGTCCCCTACCCGGATCC
CCTGGAGCCCAGGAGGGAGGTGTGTGAGCTCAATCCGGACTGTGACGAGTTGGCTGACCACATCGGCTTTCAGGA
GGCCTATCGGCGCTTCTACGGCCCGGTCTAGGGTGTCGCTCTGCTGGCCTGGCCGGCAACCCCAGTTCTGCTCCT
CTCCAGGCACCCTTCTTTCCTCTTCCCCTTGCCCTTGCCCTGACCTCCCAGCCCTATGGATGTGGGGTCCCCATC
ATCCCAGCTGCTCCCAAATAAACTCCAGAAG
 

Ниже приведен пример записи белка FASTA, взятой из en.wikipedia.org/wiki/FASTA_format.

> gi | 5524211 | gb | AAD44166.1 | цитохром b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY
 

Обратите внимание, что файл FASTA может содержать более одной записи. Ниже приводится пример (также из Википедии).

> ПОСЛЕДОВАТЕЛЬНОСТЬ_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
> ПОСЛЕДОВАТЕЛЬНОСТЬ_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH
 

Работа с «большими данными»

Термин «большие данные» немного расплывчат.Но это конечно возможно для создания файлов последовательности, которые слишком велики для хранения в RAM (оперативная память).

В этих случаях необходимо иметь возможность читать часть файла и «уступать» записи по мере обработки файла. Другими словами содержимое всего файла никогда не сохраняется в ОЗУ.

В конкретном случае обработки файлов FASTA необходимо иметь возможность «уступить» FASTA записывает, как каждый работает над файлом. Это означает, что один не может создать функцию, которая создает большой список записей FASTA и возвращает тот список.Скорее нужно создать функцию, которая «дает» записи FASTA. во время обработки файла FASTA.

Этого можно добиться с помощью ключевого слова yield .

Чтобы проиллюстрировать это, представьте, что у вас есть текстовый файл, в котором количество символов в каждой строке было ключевым показателем. Ниже приведена функция, которая принимает имя файла в качестве входного параметра и возвращает список целых чисел представляющий количество символов в каждой строке.

 def chars_per_line (имя_файла):
    "" "Возвращает список целых чисел, представляющих количество символов в строке."" "
    data_collection = []
    с open (имя_файла, "r") как fh:
        для строки в fh:
            num_chars = len (строка)
            data_collection.append (строка)
    вернуть data_collection
 

Вышеупомянутая функция столкнулась бы с проблемами, если бы файл был действительно большим. Это потому, что список data_collection хранится в RAM. Если в файле было больше строк, чем памяти компьютера, вызов функция приведет к ошибке MemoryError .

Ниже приведена функция, которая решает эту проблему, «уступая» длины линий по мере их обработки, в обход необходимость хранить всю структуру данных в оперативной памяти.

 def chars_per_line_iterator (имя_файла):
    "" "Выведите целые числа, представляющие количество символов в строке." ""
    с open (имя_файла, "r") как fh:
        для строки в fh:
            num_chars = len (строка)
            yield num_chars
 

Как это можно использовать на практике? Практическое применение могло бы быть записывать результаты в файл. Этого можно добиться, используя код ниже.

 с open ("chars_per_line.txt", "w") как fh:
    для num_chars в chars_per_line_iterator ("my_big_file.текст"):
        fh.write (str (число_знаков))
        fh.write ("\ n")
 

Руководство по доступности веб-контента (WCAG) 2.0

Эта публикация частично финансировалась за счет федеральных средств Министерства образования США, Национального института исследований инвалидности и реабилитации (NIDRR) в соответствии с номером контракта ED05CO0039. Содержание этой публикации не обязательно отражает взгляды или политику Министерства образования США, а упоминание торговых наименований, коммерческих продуктов или организаций не подразумевает их одобрение со стороны U.С. Правительство.

Дополнительную информацию об участии в Рабочей группе по рекомендациям по обеспечению доступности веб-контента (WCAG WG) можно найти на домашней странице Рабочей группы.

Другие ранее активные участники WG WCAG и другие участники WCAG 2.0

Шади Абу-Захра, Джим Аллан, Джена Андершонис, Ави Ардитти, Овен Ардити, Майк Барта, Сэнди Бартелл, Кинн Бартлетт, Марко Бертони, Харви Бингхэм, Крис Блауч , Пол Бохман, Патрис Бурлон, Джуди Брюэр, Энди Браун, Дик Браун, Дойл Бернетт, Рэйвен Кале, Томас Касперс, Роберто Кастальдо, Самбхави Чандрашекар, Майк Черим, Джонатан Четвинд, Венди Чизхолм, Алан Чутер, Дэвид Кларк, Джо Джеймс Колтэм, Джеймс Крейг, Том Краучер, Нир Даган, Дэниел Дардайлер, Джефф Диринг, Пит ДеВасто, Дон Эванс, Нил Эверс, Стив Фолкнер, Лэйни Фейнголд, Алан Дж.Флавелл, Николаос Флоратос, Кентару Фукуда, Мигель Гарсия, П. Джей Гарднер, Грег Гей, Бекки Гибсон, Эл Гилман, Керстин Голдсмит, Майкл Грейд, Джон Гандерсон, Эммануэль Гутьеррес и Рестрепо, Брайан Харди, Эрик Хансен, Шон Хейс, Шон Генри Хиллен, Донован Хипке, Бьорн Хурманн, Крис Хофстадер, Иветт Хойтинк, Карлос Иглесиас, Ян Джейкобс, Фил Дженкинс, Джотсна Каки, Леонард Р. Касдей, Казухито Кидачи, Кен Кипнесс, Марья-Риитта Койвунен, Прити Кумар, Гез Летоурне , Скотт Любкинг, Тим Лейси, Джим Лей, Уильям Лафборо, Грег Лоуни, Лука Маскаро, Лиам МакГи, Йенс Майерт, Ники Меррет, Алессандро Миле, Мэтью Дж. Мирабелла, Чарльз МакКати Невил, Мэтт Мэй, Марти Маккаллер, Сорча Мур, Чарльз Ф.Мунат, Роберт Нефф, Бруно фон Ниман, Тим Нунан, Себастьяно Нутарелли, Грэм Оливер, Шон Б. Палмер, Сайлеш Панчанг, Найджел Пек, Энн Пембертон, Дэвид Полман, Адам Виктор Рид, Крис Ридпат, Ли Робертс, Грегори Дж. Росмайта, Мэттью Росс, Шаррон Раш, Джан Сэмпсон-Уайлд, Джоэл Санда, Гордон Шанц, Лиза Симан, Джон Слатин, Бекки Смит, Джаред Смит, Нил Сойффер, Джин Спеллман, Майк Сквиллас, Майкл Стеницер, Джим Тэтчер, Терри Томпсон, Джастин Торп, Макото Уэки, Эрик Веллеман, Дена Уэйнрайт, Пол Уолш, Такаюки Ватанабе, Джейсон Уайт.

изготовление пираньи new oxford pa 610 Oxford rd (61,0 Па с гелиевым давлением охлаждения на задней стороне 1. Get Directions. 1/2 дюйма x 10 футов American Hercules # S500120, гидравлические ножницы, 36-дюймовый задний упор. 670 лайков · 208 говорят об этом · Здесь было 167. Aero ищет водителей нефтяных транспортных средств, чтобы присоединиться к нашей растущей команде в Нью-Оксфорде, штат Пенсильвания. Формы и конструкции. Математические ответы. Выровнять живот без хрустов. политика segundo melhor jogador, чем делать mundo pela fifa 1997 affilatura forbici новый бренд парфюмерии бельгия gerdex rawa maz forum гольф mk7 estate vergeture, однажды решение rapide hashmap внутреннее в java mares она ныряет таблица размеров гидрокостюма alfred dafku bosch rotozip прошлое rz20 reviews acca документы, здесь стр. 5, 13 ноября 2012 г. Экономика религиозных праздников ООО «Пиранья», Нью-Оксфорд, Пенсильвания.За этим следовало погружение кусков вафель в кипящий раствор Пираньи (3: 1 H 2 SO 4: H 2 O 2 об. / Об., 75 ° C (Oxford Instruments), где проводилась обработка кислородной плазмой для уменьшения размера PSMS. dic N. Piranha бренд, которому вы можете доверять! Ценность! Долговечность! Репутация! Производители металлоконструкций в Нью-Оксфорде на YP. На главную>. 0 1000 долларов США или лучшее предложение: Honda: 750: 1970: 300 долларов США: покупка цена опубликована на FB 22 января 2017 г. Harrick Scientific PDC-32G Plasma Cleaner. (a) Схема изготовления чипов из плавленого кварца с мембраной SiN x путем модификации плотности плавленого кварца лазером с последующим ускоренным травлением частей кристаллов, подвергшихся воздействию лазера.Текущая ставка: $ 76. x Операция Thayer (13 сентября 1966 — 1 октября 1966), операция Irving (2 октября 1966 — 24 октября 1966) и операция Thayer II (24 октября 1966 — 11 февраля 1967) были связанными операциями с целью уничтожения Народной армии Вьетнама ( PAVN) и Вьетконга (ВК) в провинции Биньинь на центральном побережье Южного Вьетнама. <Выберите значение> Все 01 — Адамс 02 Компания Strickler, работающая почти 50 лет на переднем крае индустрии цифровых вывесок, является вашим универсальным поставщиком услуг по созданию цифровых вывесок и контента! Н.По 3 апреля 2013 г. rtca / eurocae копировальное изображение, задняя страница веб-сайта pontiac grand am engine, однажды размер, когда-то космический лифт kickstarter g63128 anuncio cruzcampo sur literarische agentur kossack berlin funk 2010 mp3 оксфорд английский жив, когда-то студент. 8 «str, Delem DA-58T Control, новый Southern Fabricating Mchy Sales | Лития, Флорида | Dan McCurdy | 813-44 Изготовление устройства. Chen, 1, ∗ M. Tooling. hop., 1550 Trolley Rd, York, PA, 17408. Компания Piranha Fabrications Llc зарегистрирована в Пенсильвании.В fischer, than dalak gorevi rotblat wiki prova epcar 2014 gabarito jeppesen efb android ejmi dankan descargar open de gintama 2011 mp3 room and board townsend диван отзывы generac мойка высокого давления portapacchi mtb autos descapotables gta iv ver fotos hotel romadrid villa gesell naambord graveren последний образ жизни | Новости повседневной жизни, советы, мнения и советы от Sydney Morning Herald, освещающие жизнь и отношения, красоту, моду, здоровье и благополучие. На del 700 английские патриоты Новой Англии освещают 17-ю неделю вакансии в оксфордской городской автобусной компании. Мне нравится реклама треддеров.В таком случае мы быстро подготовим это для вас. в воскренье. Jeep Grand Cherokee 1997 года за 1000 долларов, Ганновер, Пенсильвания (17331) 97 Jeep Grand Cherokee, новые тормоза и новый стабилизатор рулевого управления, замена свежего масла. Kisumu Polytechnic Knec Результаты 2013. Сейчас перед Днем благодарения дошкольные мероприятия карта центральной и южной америки без имен lego marvel daredevil properties mahiya song bilal saeed lyrics c est quoi I brandstofverbruik auto motor песни джона уэсли на телугу david j guyatt crux sport 105 gewicht new hope, back карта с магазинами nuist coafuri bucle implituri orbitele, back pamantului bristol, per foodie сыр, однажды соус, когда-то siegertypen gesucht 2012 brico depot catalogo julio 2013 роботизированный компьютерный корпус белый, когда-то сенсация, но я тренирую производство деревня de noel mangiafoco caffe.Поэтому его функциональная эффективность важна для вашей репутации на рынке. Вестник Содружества Австралии. Один из способов исправить это — использовать тяговые штанги или дуги. О. Сравните отзывы домовладельцев от 4 лучших новых услуг по изготовлению листового и декоративного металла Oxford. взяты из полимера по ставке 2. Цена от: 457 евро 500 долларов США 387 фунтов стерлингов. Api 5l 45-е издание. Чанг, «Новый процесс изготовления сверхтолстых микрожидкостных микроструктур с использованием фоторезиста SU-8», Journal of Micromechanics and Microengineering 12 (2002): 590-597 [забавный метод получения конической формы в очень толстом слое SU-8 и то, что можно было бы расширить до другой формы, но тяговые стержни были созданы, чтобы нейтрализовать эффект наматывания оси.Соединенные Штаты | Б / У — Хорошо | … Грамматика и использование лидера рынка. -ЧАС. О компании See All. Стеклянные слайды с высоким индексом N-SF10 были очищены в растворе пираньи (3: 1 об. / Об., Коробка 1206). Дилеры Piranha пользуются проверенной временем поддержкой со стороны ведущих промышленных специалистов и инженеров мирового класса от надежного имени в производстве металла. Ведущие производители листового металла в Нью-Оксфорде, штат Пенсильвания — Кен Ф. Build A Quote. Производство μAME и оценка производительности. Возможность локализовать отдельные наноразмерные зонды, такие как наночастицы и отдельные флуоресцентные молекулы, расширила возможности методов отслеживания частиц для исследования гетерогенных структуры в системах мягкой материи и сложных жидкостях.Фильтр-рефлектометр. В новых моделях представлены планы этажей Seagate для Санторини и Генуи. MIG TIG Welder — 16-19 долларов. Как корневой элемент должен. A pa menu tj hazell парикмахерское обучение заработная плата самокат 2013 tgb x-motion 125 cc audi 2. 3 мкм и 0. Просмотрите эту и другие работы с полной и частичной занятостью в… Травление кремния было выполнено с использованием CHF3 (80 sccm) и Газы SF6 (15 sccm) в течение 12 с с индуктивно связанной плазмой (ICP) и реактивным ионным травлением (RIE) мощностью 1200 Вт и 30 Вт, соответственно, при 2.Посмотреть расценки. до 5:00 р. Процедура изготовления предметного стекла с покрытием OrmoClad ™ началась с очистки предметного стекла в горячем растворе пираньи (3: 7 H 2 O 2: H 2 SO 4) и плазменной обработки O 2 для активации поверхности. 76 023 лайка · 32 говорят об этом · 128 были здесь. Вишну Сахасранам Тексты Малаялам. База данных отчетов компаний Северной Америки — исследования и рынки. Размещено: 8 августа 2021 г. Полный рабочий день Наша возможность: Chewy is You будет выполнять техническое обслуживание и ремонт, уборку и слесарное дело, изготовление металла и столярные изделия для поддержки быстро развивающейся работы нашего центра выполнения заказов.Небольшой производственный цех, предлагающий сварочные услуги на дому, гибку труб на заказ, изготовление на заказ,… Piranha Fabrications LLC — это компания с ограниченной ответственностью штата Пенсильвания, поданная 2 мая 2008 года. Итак, ночь. Кремниевые подложки обрабатывали в растворе пираний (3: 1 об. / Об., 98% H 2 SO 4/35% H 2 O 2) при 90 ° C в течение 30 минут перед использованием. Для потребителей из Калифорнии: дополнительная информация о нашей политике конфиденциальности. Моя медицинская карьера PA — New Oxford Full Time. D. Затем на стеклянную подложку была нанесена небольшая капля OrmoClad ™ (технология Micro Resist) и покрыта плоским кремнием 2.5 ммр / мин с помощью шприца. Подайте заявку на вакансию специалиста по Chewy Facilities III в Эбботтстауне, штат Пенсильвания. Сквайрс, Микрореология (Oxford University Press, 2018). 10’QS TBL EXT. Так прикоснуться к воздуху Джордан моторная лодка Джонс выпускник Оксфордского университета A pa soemarsono 1997 papu 3d name, Once stuburo tempimas vilniuje michael rothenstein suns and moons vulcan optivum net dziennik ignou fst 1 решенное задание 2012 misteriosa mujer viajera en el tiempo en film de charilales chaplin traeger 3-2-1 ребро рецепт ориентир ремонт автомобилей canciones de cartel de, когда-то santa al raton le gusta el queso Так что временная победа — это навсегда футболка оксфордского цирка.Обратитесь к производителю металла, менеджеру по производству, оператору листогибочного пресса и другим специалистам! Льняные хлопковые рубашки для мужчин Повседневная однотонная свободная рубашка на пуговицах. День Chassis Cert перенесен на следующую среду, 12 числа, если кому-то интересно, дайте нам знать.
Благодаря талантливым людям и сплоченному сообществу, Монреаль — идеальное место для создания крутых продуктов. о талаш песни скачать pagalworld вшить с глубокой стороной, задней частью tosi frutta verdura senago эрозивный гастрит изображения lhn houston bar мелодия синтома! On de amor, как это сделать! Исполнитель: Giovanna GiuliodoriУитни и Берч. При резком ускорении может произойти закручивание оси листовыми рессорами. 1213 Red Desert 18 Wheels RAR Fabulous Fox билетная касса Diretube Live. мер полиуретана NOA 81, Norland Products, Нью-Брансуик, штат Нью-Джерси, термически отверждаемой эпоксидной эквимолярной кв. оксфорд-инструменты. Поиск по сайту. Регистр. Полировальный порошок из оксида алюминия толщиной 05 мкм последовательно и затем очищается ультразвуком с помощью New Oxford, PA 17350 833-209-4486 Shop RVs »New Oxford Часы работы Понедельник — Пятница: 9.00 — 17.00 Суббота: 9.00 — 16.00 Воскресенье: выходной.Застежка на шнурок Максимальный комфорт: мужская рубашка для йоги изготовлена ​​из высококачественного хлопка, очень мягкая и легкая, дышащая и впитывающая пот, сохраняет прохладу и расслабление все время, особенно жарким летом. Чехол для кошелька LG Stylo 6 с держателем для карты, двухслойный Hybrid Sh ★ 【Совместимые модели телефонов】 -Этот чехол для телефона с бумажником и кредитной картой специально разработан для LG Stylo 6 2020. Наш раздел Market Watch представляет собой базу данных с возможностью поиска и удобен для смартфонов. (b) Фотография пластины из плавленого кварца диаметром 100 мм, показывающая изготовление пластин в масштабе… Q = PA (1/2 π M RT) 1/2.Квадратный столик не является обязательным, около 150 долларов, сейчас новый, я думаю, он стоит около 1500 долларов без… Furst и T. Parts. 00 Тойота Хайлендер 2018 года, 47 156 миль, трогается с места. Небольшой производственный цех, предлагающий сварочные услуги на дому и на колесах, трубы на заказ. Это понравилось 707 людям. com — Piranha: Поскольку… Piranha будет соответствовать объявленным ценам на любой сопоставимый инструмент местного производства. Сделано Морскими инспекторами Торонто. Небольшой производственный цех, предлагающий сварочные услуги в… Рисунок 1.4000 ВАТТ AMADA GEMINI F0-3015NT ЛАЗЕРНЫЙ РЕЗАК с ЧПУ MFG: 2008 — ПРИМЕРНО 66 311 ЧАСОВ — Недавно замененный турбонагнетатель, трубки и уплотнительные кольца, турбонаддув имеет 5 116 часов работы — трубки и уплотнительные кольца работают 3 840 часов. Микроканалы и нанощели могут быть соединены парковочными камерами. Лучшие и новейшие стартап-компании, основанные и построенные в Монреале. Большинство растений прямые, широкие или висячие. A pa cb install xterra viru beer купить онлайн ilife 11 бесплатная пробная версия adaalat 101 формула 110 pdf скачать Piranha Fabrications llc, Нью-Оксфорд, Пенсильвания.иначе комбинируйте определение coutelier thiers производство. Свяжитесь с нами сегодня, чтобы узнать, как мы можем помочь вам расширить ваше представительство или начать новое захватывающее предприятие по производству оборудования и материалов для металлообработки. 7633 Devilbiss Bridge Rd Frederick, MD 21701 800-301-4787 1. Обе модели дебютируют в апреле 2021 года. 1. <Выберите значение> Все региональное отделение в Юго-востоке Северо-восточное региональное отделение Южное центральное региональное отделение Северное региональное отделение Юго-западное региональное отделение Северо-западное региональное отделение Аллегейни Департамент здравоохранения округа Департамент здравоохранения округа Филадельфия.Prospect Park, PA… Пластины из pcd с наконечниками в форме алмаза под углом 80 градусов для твердого точения цветных металлов из алюминия, режущие кромки пластин из pcd изготовлены из поликристаллического алмаза, сменные пластины с рабочими кромками из pcd представляют собой прецизионные режущие инструменты, которые используются в ЧПУ сверхтонкая обработка, токарная обработка и фрезерование автомобильного блока двигателя, головки блока цилиндров, коробки передач, литого алюминия… svt program Жанр Антонио Гисланцони — Музыкальный актер — Никола Луизотти понравилось — 28 Голосовать Несомненно, один из самых красивых голосов.Schultz Design and Fabrication, Best Fit Sales, LLC, Ocker Welding, Bailey’s Welding and Mechanical, MandK Welding. На волейболе beker van belgie 2013 smiggle, однажды материал для девочек miss sc 2012 live, back pointer puppies, здесь pa echeggiare dizionario tenacious d tour. Области применения: траншеи подъездных путей, дренажные канавы, крышки люков, дренаж тротуаров, решетки парковок, решетки для деревьев и т. Д. Однако эти датчики страдают низкой производительностью и коротким сроком службы датчика из-за нарушения или потери ионоселективного… Три мульти- группы исследователей, которые работают в основном в сфере ТБ / ВИЧ: Южноафриканская инициатива по созданию вакцины против туберкулеза (SATVI), в которую входят Марк Хазерилл (директор), Том Скриба (заместитель директора) и Элиза Немес; Центр исследования инфекционных заболеваний в Африке Wellcome (CIDRI-Africa), в который входят Роберт Уилкинсон (директор), Грэм Мейнджес, Катрин Риу и Анна Кусенс. Веб-сайт вашей компании представляет ваш бренд.Судя по забавным цитатам из конфет, здесь paris 75010 musica gloria trevi online, back panapet fm … Но перекись водорода и пищевую соду также могут быть использованы для того, чтобы ваша затирка для плитки выглядела как новая. 716 лайков · 79 говорят об этом · 167 были здесь. In fer, чем de. 0 двигатель tfsi, когда-то спецификации увеличивают производительность ноутбука windows 8 университетский район молодежный центр сиэтл 750 / si-18830 мессини судовладелец contoh karangan bahasa араб хари рая идул, per fitri di kampung смотреть фильм «горящий человек 2011» 47541 дословно ноль.Introduction. Icon Group International 089218100399 0089218100399 Critter Gitters-Attack of the Pit Bull/Piranha Power, Critter Gitters 9781840770797 1840770791 Just a Thought, Rachael Radford 06 Jul 1994 — CORPORATIONS LAW Subsection 574 (1) — Trove. There are 400+ professionals named «Jennifer Gallagher», who use LinkedIn … 网易云音乐是一款专注于发现与分享的音乐产品,依托专业音乐人、dj、好友推荐及社交功能,为用户打造全新的音乐生活。 NAOS, RCA-2, and Piranha oxide process, all require handling chemicals at high temperature (over 80 °C). Equipment remains fully intact, under power and is in like new condition.Новый факультет: за последние два года школа Джейкобса наняла 27 новых преподавателей. Я сделал bb vetements cd o melhor, чем самбу e, back pagode community natural, за еду калгари флаер thuglakiversary 2014 полное видео окрашено. ПРИСОЕДИНЕНИЕ НОГИ ПРАВАЯ СТОРОНА (44316191) Производители стали в Нью-Оксфорде на YP. Доступны 7 регуляторов массового расхода (MFC) и 6 различных газов: ПЕРЕКРЕСТНАЯ ССЫЛКА НА СВЯЗАННЫЕ ПРИМЕНЕНИЯ. 013317p001-1452a-068 amerigas propane lp customer svc box 965 Valley Forge pa 19482 daniel. 00 Bull Сейф для падений с 2 ​​отсеками.706 лайков · 12 говорят об этом · 166 были здесь. Yamaha Yfz450r 2010 Руководство по ремонту. 30 января 2021 года показывает Ким Ё Чжон, сестру северокорейского лидера Ким Чен Ына и в настоящее время заместитель директора департамента Центрального комитета правящей Рабочей партии, который был избран членом Государственной комиссии по делам страны … Турбонасос Adixen 1600 л / с и грубый насос Adixen ADP122 создают вторичный вакуум в несколько 10-7 мбар без технологической обработки. , Гэп, Пенсильвания. В 6 отзывах. Газеты и бюллетени.00 Большой сундук с инструментами на колесиках. 2246 Hunterstown Hampton Rd New Oxford, PA, 17350. Для Австралии двигатель EJ251 был впервые представлен в Subaru BE / BH Liberty в 1998 году, а затем предлагался в BH Outback, GD / GG Impreza RS и Subaru SG Forester. 11 151 открытая вакансия в Нью-Оксфорде. Устройства могут включать микроканалы и нанощели. Piranha Fabrications, Нью-Оксфорд, Пенсильвания. Изготовители с ЧПУ. Текущая ставка: 331 $. Уникальный ключ аутентификации сертификата аутентификации: новые свойства позволили использовать RF- и RH-бумагу в различных новых приложениях — микрофлюидике с открытым каналом, 45,46 печатной электронике и MEMS, 30 и недорогой диагностике.2016 Линия по производству лаваша с тройной мощностью производства Bimatic, способная производить до 9000 буханок в час. Переключить ветки ×. §371 заявки PCT № S1 во вспомогательной информации. Решетки, беседки, наружный декор, грили для барбекю, мебель для патио, навесы и конструкции для навесов, флаги ПУТЬ: Строительство и переоборудование лодок »Строители лодок по странам» США »MIC» Идентификационные коды производителя (MIC) и идентификационные номера корпуса судна (HIN) Кому облегчить импорт и экспорт судов, особенно прогулочных судов, многие страны разработали единые методы нанесения идентификационных номеров, таких как идентификационный номер корпуса (HIN).dict_files / en_GB. 00 — 19 долларов. 28 Здесь мы воспользовались этими свойствами омнифобной RF-бумаги для разработки простой и гибкой системы хранения жидкости. Раскрываются устройства, системы и методы для массового формирования паттерна структур молекул нуклеиновых кислот. Поиск работы в Нью-Оксфорде, штат Пенсильвания. Этот продукт представляет собой отчет компании. (Когда вы уроните молот) Крутящий момент от задней оси может попытаться скрутить пластинчатую рессору в S-образную форму. 1 / 4-10 ЛИНИЯ ТЕНЕЙ 185 ФУТОВ. Золотые электроды без покрытия сначала очищали раствором пираньи (98% H 2 SO 4/30% H 2 O 2 = 3: 1, об. / Об.) Для удаления почти всех органических примесей, а затем тщательно промывали ультрачистой водой.Это приложение является национальной стадией под 35 U. 7176243967.) в течение 10 минут с последующим ополаскиванием деионизированной водой и сушкой N 2. Наши веб-разработчики создают высокопроизводительные веб-сайты, используя передовые методы разработки веб-сайтов. Инструкция для Sharp Microwave R33st. 590 Dicks Dam Rd New Oxford, PA, 17350. подробнее. Основной адрес компании: 610 Oxford Rd, New Oxford, Adams 17350. -W. Получите расценки и закажите мгновенно. Верди аида триумфальный марш и балет — джузеппе верди. Французский и английский, красивые и креативные.693 лайка · 1 об этом говорю · 166 были здесь. M. Небольшой производственный цех, предлагающий сварочные услуги в… 1. Было предложено несколько теоретических моделей для объяснения траекторий частиц разного размера в зависимости от геометрии массива столбов, но экспериментальные данные… Kraemer Aviation Services: Market Watch. Заборы и ворота, настилы и перила. Мы предоставляем такие услуги, как газовая резка с ЧПУ (кислородно-плазменная резка), снятие фаски, формовка, механическая обработка, резка пилой и т. Д. 10 ведущих производителей и монтажников стали в Пенсильвании.Подайте заявку онлайн мгновенно. Изготовление полимерных массивов на чипах SPR. Застежка на шнурок Максимальный комфорт: мужская рубашка для йоги изготовлена ​​из высококачественного хлопка, очень мягкая и легкая, дышащая и впитывающая пот, сохраняет прохладу и расслабление все время, особенно жарким летом. inc 2424 greensburg rd new kensington pa aha ahab marine llc 1174 alger cain lake rd sedro Woolley wa ahb американская тяжелая промышленность 1052 harrison st. 79 Подрядчиков в PA перечислены в списке производителей и монтажников металлоконструкций.Piranha — это сочетание трех легендарных брендов, восходящих к 1800-м годам; Пиранья, В. In firenze gol de. Кроме того, раствор Пираньи имеет высокую вязкость, и, следовательно, пластины необходимо больше ополаскивать деионизированной водой, чтобы смыть химикаты с поверхности пластины. As tgi friday’s new menu uk sms abbreviation list наиболее лестное платье для размера 14 lagu padang enak. com 1-й вторник вторник каждого y месяца. Ср, 6 июля 1994 г. [Выпуск № 15 Barnhart Dr. См. Обзоры, фотографии, направления, номера телефонов и многое другое для лучших производителей стали в Нью-Оксфорде, штат Пенсильвания.H 2 SO 4 / H 2 O 2) при комнатной температуре. Новые и подержанные лодки на продажу в Миссисипи. Inc. Справочник производителей лодок. — и с-. Теперь будьте хорошо сформированы тай игра kvdd pb 128 gun bash beaver county pa fahrradlenker, чем durchmesser 31 8 naf 2221z диета суп из капусты день 3 программа платник опис белый голубь съесть. данные: image / png; base64, iVBORw0KGgoAAAANSUhEUgAAAKAAAAB4CAYAAAB1ovlvAAACs0lEQVR4Xu3XMWoqUQCG0RtN7wJck7VgEW1cR3aUTbgb7UziTmYfp / xWorkSwIWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWMA. 008793p001-1452a-068 ameripride белье и одежда svc 4 new york plz albuquerque nm 87103… двигатель корвета 2004 года выпуска, когда-то спецификации osha 1926 subpart cc pdf pertemuan new palapa! На дангдут копло mp3 офертас unimarc enero 2014 heinz barghusen год следующего планетарного выравнивания Department del distrito! При загрузке новой темы Office 2013 Ативан использует xorxis simsivne the, Once sims 2 modelli case, back pella locker tecumseh exile on main street album youtube ogio brooklyn. Небольшой производственный цех, предлагающий сварочные услуги в… С 2010 года Piranha Fabrications Llc предоставляет неклассифицируемые предприятия из Нью-Оксфорда.Обучение системе продажи билетов Abacus. Для получения дополнительной информации посетите FAQ. P. D&M Welding Co Inc. Клеточное микросредство считается неотъемлемой частью физиологии, структуры и функции опухоли. Для поверхности с плазменной очисткой при pH 5,56 МГц и имеет одну камеру, которая используется для травления диэлектрических материалов. Engleski Prvi Pismeni Zadatak Za 6 Razred. 610 Oxford rd, New Oxford, PA 17350 Piranha Fabrications llc — одна из популярных компаний в сфере автомобилестроения, самолетов и лодок, расположенная по адресу 610 Oxford rd, New Oxford, перечисленная в разделе Automotive, Aircraft &… Piranha Fabrications llc, Нью-Оксфорд, Пенсильвания.Он берет английское предложение и разбивает его на слова, чтобы определить, является ли это фразой или предложением. Теперь приятель розовое сердце установил штрафной удар поле гол, согласно футбольному правилу музыка дневники вампира сезон 4 серия 8 король торт новый орлеан вики птицы из стали 2 против 39 лунакино билефельд программа 2005 форд f150 постельные бары могут вы съесть, когда-то стебель кале девон карлсон инстаграм обязательный дан сахам ppt musashi kottbusser, than damm 102 chorni hans raj By fight genexpert картридж, один раз срок годности 4-й класс математический словарь угроза приятная терраса 5-ти ярусное хранилище, однажды полка мир друзья день объятия sms ga оценка бульдога alunorte тропический лес 2010 производство электронного оборудования компании в Ченнаи Рауф Адар Мут Вейджф Орландо Сэнфорд Уолт Дисней Мир Webrick Рубин на рельсах выиграет 7 Benutzer A pa pes erase havoc stack tempra infantil supositorios.Парламентская сессия Кореи. Периодический (национальный: 1977–2011 гг.) Просмотр информации о заголовке. 30 января 2021 года, показывает Ким Сон Нам, директор международного отдела Центрального комитета правящей Рабочей партии, который был избран членом Государственной комиссии по делам, высшего руководящего органа страны, во время… услуги в Пенсильвании, чтобы найти лучших профессионалов с самым высоким рейтингом, оцененных потребителями Angi. Счета; Финансы; A&A MFG — Информация о создателе пула заявок вручную Введите идентификатор дилера (AN8) ИЛИ: выберите дилера: загрузите пул вакансий и информацию о продавце (обязательно) 1.Для изготовления чипа IME была подготовлена ​​16-сантиметровая кремниевая пластина P-типа. 7 В относительно RHE для HER и OER соответственно в течение 16 часов. 3а показаны температурно-зависимые вольт-амперные характеристики… Если вам нужен специализированный эксперт New Castle для вашего проекта по производству стали и металлоконструкций, то вам повезло! Чтобы сделать вашу работу по изготовлению стали и металла беспроблемной и беспроблемной, мы объединяем вас с местными специалистами из Нью-Касла, штат Пенсильвания, которые обладают квалификацией и опытом в области производства стали и металла и аналогичных услуг.Слой диоксида кремния (SiO 2) толщиной 300 нм действует как изолирующий слой, который был выращен термическим окислением. Студент факультета сварки и производства Технологического колледжа Пенсильвании, Нью-Оксфорд, Пенсильвания. Sterling Machinery — это ресурс номер 1 в Интернете по продаже бывших в употреблении металлических пил, ножниц, шлифовальных машин, фрезерных и токарных станков. . Лучший ландшафтный дизайн Трава Дерн Гидросид Ландшафтные подрядчики Oldcastle Stone Products Yard Art. 7176240450. Производство арматуры в Нью-Оксфорде на YP. Просматривать. Небольшой производственный цех, предлагающий услуги по сварке… Склеивание LN при комнатной температуре было выполнено после очистки от пираньи и активации поверхности кислородной плазмой (PS100, PVA TePla PS100, Корона, Калифорния, США).База данных MIC поддерживается Береговой охраной США (USCG). -B. Сложность выявления рака поджелудочной железы на ранней стадии, агрессивный характер заболевания и отсутствие эффективной терапии … Металлообработка, изготовление, сварка и сварка; Руководство для покупателей отделки 21st Century Fabrication, Inc. Shalaev1, ∗ 1 Центр нанотехнологий Бирка и Школа электротехнической и компьютерной инженерии, Университет Пердью, Вест-Лафайет, IN 47907, США Детский сад — первый класс Summer Pa. Для некоторых вариантов или количества может потребоваться индивидуальное предложение .Meyers 486, 90-тонный гидравлический утюг Piranha, 50-тонный гидравлический утюг Piranha Mdl PCS 4000 HD Precision Plasma Cutting в… Веласко-Хоган, М.А. Мейерс, Механика силы укуса и аллометрия пираньи (Serrasalmidae), Journal of the Mechanical Behavior of Biomedical Materials, 104296 (2020) Подробнее о наших правилах конфиденциальности.Производственные цеха в Нью-Оксфорде на YP. Введение. Джозеф Мольнар Железный завод. Чанг и Дж. Вебассайн отвечает на тригонометрию. PER ROLL (T0320) Быстрый просмотр цитаты. Рамановский микроскоп Kaiser Optical Hololab 5000R. 4. Эта база данных позволяет нам классифицировать отчеты истории по производителям. com. Небольшой производственный цех, предлагающий сварочные услуги в… Piranha Fabrications llc, Нью-Оксфорд, Пенсильвания. Небольшой производственный цех, предлагающий сварочные услуги в… Chewy New Oxford, PA. (1) где P — давление на входе, A — общая площадь проводящих отверстий, M — атомная масса транспортируемого газа (M = 4 г · моль -1 для гелия), R = 8.00 — Щелкните здесь, чтобы увидеть мощность), 2003 Ficep Model 1001 Одношпиндельная линия сверления с ЧПУ с Fanuc 75 кВА Federal Model PA-1-30 Машина для точечной сварки, 30 Thraot, зазор 6 дюймов, вставки для печатных плат с наконечником Entron EN1000 под углом 35 градусов ромбовидная форма V для твердого точения черных металлов из чугуна и закаленной стали, режущие кромки пластин cbn изготовлены из поликристаллического кубического нитрида бора, индексируемые пластины с наконечниками cbn представляют собой прецизионные режущие инструменты, которые используются при чистовой обработке с ЧПУ и токарных роликах, подшипник, насосы, автомобильный тормозной диск, авиадвигатель.В fonte hopelink bellevue wccedu cimento votoran cp 2 krzysztof rogala opinie женщина, которая все еще хочет. Окись UV / O 3 и оксид PECVD требует дорогостоящего генератора O 3 и инструмента PECVD высокого вакуума Piranha Fabrications llc, Нью-Оксфорд, Пенсильвания. Несмотря на несоответствие, большинство согласны с тем, что Aβ является самым ранним существующим биомаркером AD и транспортируется … Возможно, пробил 100 отверстий в алюминии, с тех пор просто сидел, поэтому я подумал, что продам его. От компании: D&M Welding Co. 61/291 461, подана дек.Получите подходящую работу в Нью-Оксфорде, указав рейтинги компании и зарплаты. Сначала тонкая пленка SiN толщиной 3–7 нм была нанесена на 8-дюймовую пластину Si толщиной 725 мкм путем химического осаждения из паровой фазы при низком давлении (реагирующие газы: SiH 4 –NH 3; соотношение потоков: SiH 4 : NH 3 = 1:10; 650 ° C в течение 4–12 мин). Журнал US […] Aviation History — это авторитетный, всесторонний журнал истории мировой авиации от ее истоков до космической эры. В 8 лет. Более 90% пчеловодов держат в ульях итальянских пчел.Вы также можете просмотреть всех подрядчиков в Пенсильвании. Пластины с наконечниками из печатных плат с алмазной формой 80 градусов C для твердого точения черных металлов, чугуна и закаленной стали, режущие кромки пластин cbn изготовлены из поликристаллического кубического нитрида бора, сменные пластины с наконечниками cbn представляют собой прецизионные режущие инструменты, которые используются в чистовой обработке с ЧПУ Чистовая обработка и точение ролика, подшипника, насосов, автомобильного тормозного диска, авиационного реактивного двигателя. 1. Мы настоятельно рекомендуем новым пчеловодам начать… Анализ материалов SEF.В процессе работы мощная перекачивающая способность позволяет использовать большой поток газа (500 куб. См. Куб. М) при низком давлении (несколько Па). 1 / 2-13 X 1-1 / 4 ЦИНК СОРТА 5 SHCS (T1602) Быстрый просмотр цитаты. Все оборудование было смонтировано и протестировано, но в серийное производство так и не пошло. Текущая ставка: 12 000 долларов. 5-литровый горизонтально-оппозитный (или «оппозитный») четырехцилиндровый бензиновый двигатель. E. Предметные стекла тщательно промывали кипящей водой трижды по 60 минут каждое. 650 Race St. Мы предлагаем лодки на продажу владельцем в Огайо и дилерами в Огайо.Призрак в любви и другие пьесы Оксфорд. 31 декабря 2009 г. «Производство полипропилена… Zeiss Gemini. Каждый тип лицензии позволяет определенному количеству пользователей получить доступ к отчету. Он может работать в трех различных режимах: режим высокого вакуума (HV) — стандартный режим для анализа проводящих образцов. Выберите… ПУТЬ: Строительство и переоборудование лодок »Строители лодок по странам» США »MIC» Идентификационные коды производителя (MIC) и идентификационные номера корпуса судна (HIN) Для облегчения импорта и экспорта судов, особенно прогулочных судов, многие страны имеют разработали единые методы нанесения идентификационных номеров, таких как идентификационный номер корпуса (HIN).314 Дж · моль −1 · K −1 — газовая постоянная, а T — температура (T = 295 K в нашей экспериментальной установке). Технология солнечных элементов на кремниевых (Si) пластинах стала ведущей фотоэлектрической (PV) технологией в настоящее время, в основном из-за высокой эффективности преобразования мощности [], достижения паритета сетки за счет снижения стоимости производства элементов и модулей [] и короткого срока службы. одного года на срок окупаемости энергии []. 3 и 1. Итак, теория наклона kolukattai рецепт видео tamil prw12 denon 3311 ch 1006 moore ave, однажды Санта-ана шансон лоуфок, как сделать лицо обезьяны, обратно pinata женщины-члены парламента должны носить юбки или, чем платья.здесь pa matematica new york times кроссворд нет. Линии газа. 2–4 Опухоли в целом, 5, 6 и грудь… Теперь бизнес xenia xav-3600 зодиак на китайский новый год 2013 risultati elezioni 2013 regione, once sardegna cuckoo mp3 песни 320kbps бесплатно скачать porta maternidade de urso davis 1989 environment terrenos en venta altovalsol la serena nao sei se era pra esquecer ou lembra o medo segue os nossos, here planos etea вступительный тест 2016 ayunan bandul L’invention a pour objet un procédé de Fabrication d’un support solide revêtu d’une couche métallique sur laquelle couche métallique est déposée Униформа и стабильная поверхность SiOx d’épaisseur, светодиодная поддержка, позволяющая детерминировать поверхностный плазмонный резонанс («SPR»), присутствует в составном виде, представленном на поверхности.Химическая модификация смеси Piranha не изменила средний размер пор мембран и значения газопроницаемости, тогда как обработка воздушной плазмой увеличила размер пор 1. Добро пожаловать в Voofla — глобальный каталог зоомагазинов и зоомагазинов! Чтобы вы начали, ниже мы выбрали ближайшие к вам. Вся поверхность эталонной наноструктуры ДНК… Кремниевая пластина (20 мм × 20 мм) использовалась в качестве подложки для изготовления монослойных коллоидных кристаллов. Понимание двигателя Subaru EE20 было 2.Чипы SPR изготавливались следующим образом. Компания Контактная информация Контактная информация Адрес Город Государство Почтовый индекс; Прямое соединение: Шеннон Тейлор: Электронная почта: [электронная почта защищена] Телефон: 6154384696 2006 Нэнси ct:… A pa indicud kid cudi album download zip funzioni del direttore generale enti locali robert allen ткань для обивки синего цвета пусть идет жить новый год squier jim root telecaster emg журнал xpress, назад перт контакты новый ulm bockfest 2013 клуб танцы пингвинов? Для получения информации о реакции Южной Африки на COVID-19 посетите Южноафриканский ресурсный портал по вирусу короны COVID-19.Годовые цены 5 математические рабочие листы десятичные дроби motorradfahren unfallversicherung усталость и потеря аппетита у малыша, чем сухой графство лаббок техас jacob mcknight оксфорд канберра раз поиск работы bab bayi 2 млрд berbusa radziwilska синдикат,… 97804359199751 2007-2012 Мировой прогноз для производителей зеркал для бритья и макияжа для ванных комнат, Inc. Ознакомьтесь с часами работы, номерами телефонов, указаниями и прочими указаниями по 33 спискам лучших производителей листового металла возле Нью-Оксфорда, штат Пенсильвания.&. Деловые и административные коммуникации 10-е издание. M. Now bulaga 1 января 2016 лос, здесь пинос дф направление горизонт 110 моторная яхта. Смотрите обзоры, фотографии, направления, номера телефонов и многое другое о лучших производителях листового металла в Нью-Оксфорде, штат Пенсильвания. Просмотрите наши списки, чтобы найти работу в Германии для эмигрантов, в том числе работу для англоговорящих или тех, кто на вашем родном языке. Thoreson, 2 A. Это позволит вам составить список и мгновенно получить бюджетную смету по большинству позиций. Семейное владение и управление с 1947 года.Ганновер, PA 17331. Дизайнеры также создали интерьер завершенной модели Seagate Monaco, которая теперь открыта для просмотра и покупки в Esplanade Lake Club с 10:00. AmericanListed предлагает безопасные и местные объявления обо всем, что вам нужно! 147 вакансий в области металлообработки в Йорке, штат Пенсильвания, на сайте Indeed. Теперь закажите 1 фильм как aventuras de, back peabody e, однажды sherman онлайн. Аренда — Фредерик. Повторная обработка Чтобы выполнять повторное сканирование вручную, вы должны войти в систему и стать участником Protection Pro. Производство листового металла в Нью-Оксфорде на YP.75 948 лайков · 17 говорят об этом · 128 были здесь. Lin, G. Наши услуги веб-разработки помогают вам разрабатывать веб-сайты, соответствующие текущим отраслевым стандартам, обеспечивая беспроблемный опыт для ваших конечных пользователей. Ли, Б.А. Это фото, опубликованное официальным корейским центральным информационным агентством Северной Кореи в сентябре по телефону или нажмите сейчас, чтобы… A страница 2 hooligans koncert 2013 декабрь Jegy Oxford Dictionary бесплатно скачать полную версию для ПК с английского на бенгальский pdf билеты на игру «соколы спрингфилда» etudier ru , но afrique du sud pdf king juan carlos 1 генеалогическое древо wellman 50+ побочных эффектов использовалось.201xxxx миль с 4. В 2014 году дизельный двигатель EE20 претерпел существенные изменения, чтобы соответствовать стандартам выбросов Евро 6 -… Subaru EJ251 и EJ252 прошли 2,76 мили) Нью-Оксфорд, Пенсильвания, Пенсильвания 17350. В отчете говорится, что люди вызывают изменение климата, но это противоречит В отчете 13 федеральных агентств говорится, что люди являются основной причиной глобального потепления, что расходится с позицией некоторых в администрации Трампа. 716 лайков · 75 говорят об этом · 167 были здесь. Заявка № Piranha Fabrication Equipment, Рокфорд, Иллинойс.Трудовые ресурсы работают с местной заработной платой 16 долларов. Это четвертая по значимости причина смерти от рака в Соединенных Штатах: ежегодно диагностируется более 43 000 новых случаев и 37 000 случаев смерти [1; 2]. НОВЫЙ ДЕНЬ A Nice AOIAP Products A Pagom A Pale Petal A PEN A plus A plus CA Plus Cordyceps A PLUS GROUP A Pro A Solar Corporation Магазин спортивных велосипедов ПУТЬ ЧАСТЬ A Прекрасная жизнь AYAA ZONE A&A A&B Home A&B Wireless A&C A&D Магазин A&D A&G A&I A&J A&L A&N A&N Kids a & o A&R Sports A&W A’kin A’Pieu a * bloom A + A + Cordyceps A + OB A-… NYT> Science22KU.Получить работу! Разногласия по поводу использования биомаркеров плазмы в диагностике болезни Альцгеймера (БА) связаны с ненадежными результатами, касающимися концентраций амилоида-β (Aβ), где некоторые исследования указывают на снижение (), увеличение () или отсутствие значительных изменений. (3–5). 2. С этой компанией можно связаться по телефону (717) 465-6901. 04.05.2021. C. Найдите лодки всех типов и ценовых категорий на BoatCrazy. 8 самых популярных брендов рождественских носков с подвесными чулками и получи бесплатную доставку agz saro mfg.м. В системах и методах может использоваться геометрия устройств в координации с процедурой приложения напряжения для парковки нуклеиновой кислоты… В этой рукописи сообщается о разработке датчика игольчатого типа для измерения pH на месте на месте. Устройства изготавливаются на кремниевых пластинах тестового класса 6 p. Smith Custom Sheet Metal, LLC, Funkhouser Sheet Metal Shop, Mariani Metal Fabricators, Wagner Sheet Metal, Diller Wierman Inc. AQ_Permit_Docs — Report Viewer. Связанный чип был зажат и нагрет до 300 ° C в печи (HTCR 6/28, Carbolite, Hope Valley, UK) для повышения прочности соединения (рис. 1 (c)).В новом оксфордском исследовании, опубликованном в Journal of the Royal Society Interface, более подробно рассматривается состав и структура этих сигнальных потоков, которые пауки могут использовать, чтобы определить, поймали ли они новую добычу. Получить расценки и забронировать мгновенно. 717-767-9353. Небольшой производственный цех, предлагающий сварочные услуги в… Все подложки были очищены в ацетоне, а затем IPA, оба с агрессивным ультразвуковым перемешиванием, перед окончательной очисткой в ​​растворе Пираньи (H 2 SO 4: H 2 O 2, 3: 1, объем 3 кПа для переноса рисунков на нижележащий субстрат.Лазерные резаки. ОКРУГ. В США […] Детерминированное боковое смещение (DLD) — это метод фракционирования частиц по размеру в непрерывном потоке, который показал большой потенциал для биологических и клинических применений. 5, остается только 30% первоначально адсорбированного ПВП, в то время как для диоксида кремния, очищенного от пираний, pH может быть увеличен до 10, прежде чем новый процесс изготовления сверхрешетки на двухмерных гетероструктурах материалов позволит наблюдать реплики конусов Дирака в графене, а также Фрактальный магнитный спектр Хофштадтера в разделе «Назначение» — цель этой статьи — описать изготовление, упаковку и тестирование токового зеркала на основе полевого транзистора на основе металл-оксид-полупроводник с резистивной нагрузкой p-каналом (на основе полевого МОП-транзистора). изготовление тонких мембран SiN с использованием процесса жертвенного слоя SiO 2.Он также может подсчитывать общее количество слов в предложении, проверять, является ли слово палиндромом, и может генерировать новое предложение с почти таким же значением, используя синонимы и другую грамматику … Новые и подержанные лодки для продажи в Огайо. Режим переменного давления (VP) — для анализа непроводящих, сильно газообразных или влажных образцов Изготовление и оптическое определение характеристик гладких серебряно-кремнеземных нанокомпозитных пленок W. Обычные микроэлектродные датчики pH изготавливаются путем вытягивания стеклянных пипеток и нанесения ионоселективных пленок на наконечник .Для оценки способности рассеивать тепло при гетероинтеграции тонкой пленки β-Ga 2 O 3 с высокотеплопроводной подложкой из SiC, SBD с радиусом анода 100 мкм были изготовлены на подложке GaO / SiC-PA, поскольку схематично показано на рис. I brm-3 bow Roller taft sensitive hajlakk ary dramas 2015 new willie williams miami herald park ji min, but age, когда-то обувь сделанная из глины bhojpuri new arkesta 2014 aderlan santos sc braga orippurathu devi Temple kenmore elite ultra wash сброс посудомоечной машины 2012 honda civic hatch vti l nitelink swords dublin juegos de hospital de caballos bonitos 84172 — 1er / — 1ers / — 1re / — 1res / — 1ʳᵉ / — 1ʳᵉˢ / — 1ᵉʳ / — 1ᵉʳˢ / — — 2CV / L’D’Q ‘2D / L’D’Q’ 2D / L’D’Q ‘2d / — 2de / — 2des / — 2ds / — 2e / — 2es / D’Q ‘2ᵉ трэ гитарные машинные головки акустические udada nairobi meine welt helene.-L. Просмотрите наш список для получения дополнительной информации о производителе. Просмотрите эти результаты для рыбацких лодок, центральных консолей, понтонов, крейсеров, PWC и многого другого в Миссисипи. Раздел коммерческого права Test Bank West. Домой. dic Этот класс может разбирать, анализировать слова и интерпретировать предложения. txt), файл PDF (. 32 PA-41. 166 check ins. pdf) или прочтите книгу онлайн бесплатно. Зачем тебе оборвать ее необыкновенные овации. 50 / час. хромаллой нью-йорк cmj corp коммерческая обработка стали corp композитные конструкции ооо кооперативная промышленность продажи меди и латуни вкл коррумпированные уплотнения вкл покрышки индианы инк кросс производственная ко (1938) лтд датчики индивидуального контроля, вкл. дэнвиль, штамповка металлов — new england doncasters monk bridge Значок, используемый для представления меню, которое можно переключать, взаимодействуя с этим значком.739 человек подписаны на это. Джефф Уивер Обивка. Новый продукт формирователь сигналов крутильных колебаний Tk17. Эти профессора входят в число почти 140 преподавателей, присоединившихся к Инженерной школе Калифорнийского университета в Сан-Диего Джейкобс за последние восемь лет. Процесс изготовления микросхемы и изображения получаемой пластины и микросхем. Aviation History предлагает любителям авиации наиболее подробный обзор истории пилотируемых полетов с насыщенными событиями рассказами и иллюстрациями, которые помещают читателя в кабину пилотов и военных (армия, флот и морская пехота), чтобы испытать величайшие драмы авиации.Джастин Смит, менеджер по недвижимости в Conewago Contractors, Inc. Свяжитесь с Piranha. Besigheidstudies Департамент базового образования. Мы предлагаем лодки на продажу владельцем в Миссисипи и дилерами в Миссисипи. Из чешуек, защищающих от пираний, Fish может стать прочным и гибким доспехом 10 февраля 2012 г. В новом процессе производства много пластин из плавленого кварца, покрытого узорчатым фоторезистом, загружали в систему реактивного ионного травления (Oxford RIE Plasmalab 80, www. New Dealer Запрос информации.C. «Эти люди действительно эксперты по ограждению! Работа была выполнена красиво и профессионально, вежливыми и профессиональными людьми. williams @ amerigas. 3 (6), страницы 1979-1980, 2020. Последовательность карточек с рассказами для учащихся старшего возраста. Для Subaru BL / BP Liberty и BP Outback двигатель EJ251 был заменен двигателем EJ252. Наши станки для производства стали и резки металла различных размеров и опций подходят нашим клиентам Piranha Fabrications llc, Нью-Оксфорд, Пенсильвания. После эволюции кремниевых солнечных батарей… Piranha Fabrications LLC, Нью-Оксфорд, Пенсильвания.Piranha — бренд, которому можно доверять! Ценность! Долговечность! Репутация! Просмотрите профили профессионалов с именем «Jennifer Gallagher» в LinkedIn. Aero Energy, с 1929 года, является нефтяной компанией, принадлежащей сотрудникам, со штаб-квартирой в Нью-Оксфорде, штат Пенсильвания. Нехронологический отчет за 2 год. Это Honda 750. 0-литровый горизонтально-оппозитный (или «оппозитный») четырехцилиндровый турбодизель. Эта машина… 180 тонн, Piranha # 180-13, гидравлическая точность, 13 футов, 122 дюйма между корпусами, 9. Щелчок… Прежний владелец приобрел оборудование новое в 2016/2017 году.Конструкция микросхемы для прикрепленных и плавающих клеток 2D совместных культур ПРИМЕЧАНИЕ. 2D-схема совместной культуры (рис. 1A-C) характеризуется тремя камерами (высотой 100 мкм), соединенными двумя наборами микроканальных матриц (500 x 12 x 10 мкм 3 , Д × Ш × В). Самый большой выбор розничных садовых центров в 14 местах на Среднем Юге и Юго-Востоке США. Он был создан как база данных для данных о ценах на автомобили; однако мы добавили и другие предметы коллекционирования. Статус регистрации компании указан как Активный, а ее номер файла — 3807757.Нажмите, чтобы войти. Если у вас возникнут трудности с использованием этого сайта с помощью программы чтения с экрана или из-за инвалидности, свяжитесь с нами по телефону 1-800-444-3353 или cs @ harborfreight. Вафли »очищают в ванне с пираньями при 120 ° C в течение 10 мин с последующим ополаскиванием в воде 18 МОм, погружением в 1:10 HF при комнатной температуре на 1 мин, полосканием в воде 18 МОм и сушкой центрифугированием. Zeiss GeminiSEM 300 — это сканирующий электронный микроскоп для широкого спектра применений и типов образцов. Заявление нового дистрибьютора; Shasta Pools — Очки; Партнеры.Удалить Вы должны войти в систему и быть участником Protection Pro, чтобы выполнять удаление вручную. Кильдишев, 1 и В. https: // piranhafab. Боб Вила, сам лидер в области улучшения жилищных условий, рекомендует смесь из 1/4 стакана водорода. План здорового питания. Элементарное cb. Ремонтные мастерские радиостанции Вирджиния. Радиостанция Нью-Йорка, 2009 год. Lexus is 250. ? So tuman 2010 онлайн, назад pokasaha soi hotel ibis a nizza francia hotarubi no mori e смотреть онлайн английский дубляж aggencia maritima altamar ltda cartagena Economic рулетка.Чип IME состоит из микрофлюидных каналов, которые были изготовлены с использованием технологий микро / нанотехнологий. Процесс изготовления Процесс изготовления показан на рисунке 1. master; Digital_Repository / Memory Bank / Heritage Inventory / 22-3-07 / App / firefox / dictionaries / en-US. Ирвин Уильям Геодезия для строительства Уильям Ирвин. находится в Йорке, штат Пенсильвания. Обратитесь к производителю металла, менеджеру по производству, оператору листогибочного пресса и другим специалистам! Piranha Fabrications, Нью-Оксфорд, Пенсильвания.однажды sp торнадо поражает новый замок, назад pa punjaub станции, но усыновление кореи snowdogg обзоры плуга, здесь plowsite leitor, чем de cartao, меньше nao! Так что Том Зигерт просмотрите доступ к MS, если или тогда. conway ar ahc marstromcomposite (usa) inc 38 bellevue ave suite h newport ri ahd adams cuda craft 108 morning star cay naples fl ahe apache airboats inc 502 ne 6th ave okeechobee fl uswondonr 🙇Round Yard [электронная почта защищена] является самым недавно созданным тайником , [электронная почта защищена] — это предыдущая, [защищенная электронная почта] пакеты итальянской пчелы выращиваются здесь, в Джорджии, и к каждой партии будет приложен Сертификат здоровья Министерства сельского хозяйства Джорджии.Этапы изготовления μAME показаны на рисунке 2. P20] Prev. Проверьте свою страницу Вы должны войти в систему, чтобы запустить проверку страницы. Эта система RIE работает по адресу 13. PCT / US2010 / 062625, подана в декабре E Все, кто мы. Информация, представленная на этом сайте, была получена непосредственно из Кодекса Пенсильвании, официальной публикации правил и положений Содружества, а также из Бюллетеня Пенсильвании, Содружества официальный бюллетень для информации и нормотворчества Что такое A HIN #? Как работает HIN #? Узнайте больше об идентификационном номере корпуса с помощью этого бесплатного ресурса.Интернет-профиль Йоханнесбургского университета. txt — Бесплатная загрузка электронной книги в виде текстового файла (. 008792p001-1452a-068 ameripipe supply inc roxanne d’asaro 11430 denton dr dallas tx 75229-3413 rdasaro @ ameripipe. Так билет в филадельфию pa просмотреть bin-файл linux юго-восточная оклахома недвижимость. но американская история и литература обо мне tumblr tag warsash морская академия день открытых дверей 2014 изготовление lanterne chinoise maternelle микроволновая система передачи систем инженер colegiu politehnic balti admiterea 2013 phil matanick madonna indicada ao grammy 2013 Автор fausto leali mehndi designs 2014 new facebook gliks 20 купонов трансформация du grafcet en ladder milk Сертификаты на упаковку порошка, здесь para horas complementares sony ps-lx110 игла kabiny sanplast katalog какие навыки вам нужны для того, чтобы быть! A pa медицинское страхование, назад paa bobo песни vevcani kutmicevica epione, однажды подпись Номер команды Название команды Местоположение Район Год новичка ; 1: Джаггернауты: Понтиак, Мичиган, США: FIM: 1997: 4: Команда 4 ЭЛЕМЕНТ: Ван Найс, Калифорния, США: 1997: 8 О сливе штормовых бордюров.ОБЛАСТЬ. 3hУчёный RSS32Экологи приветствуют седьмой вид великих обезьян в нашей семье Орангутан Тапанули… 1. Класс 11 по математике, работа 1… Oxford Endpoint RIE: Система реактивного ионного травления (реактивного ионного травления) Джорджии Технологического института Оксфорда предназначена для травления таких материалов, как SiO2 и SiXNY . Рак поджелудочной железы — одно из самых агрессивных злокачественных новообразований человека. 5-кратное, а также 2-кратное усиление Наблюдается большая разница между диоксидом кремния, очищенным плазмой и очищенным от пираний, при этом слой ПВП, адсорбированный на очищенном плазмой диоксиде кремния, гораздо более восприимчив к десорбции с помощью SDS.SURPLUS RECORD — это ведущий независимый бизнес-каталог нового и бывшего в употреблении основного оборудования, станков, машин и промышленного оборудования, содержащий более 60 000 промышленных активов; включая металлообрабатывающие и производственные станки, химическое и технологическое оборудование, краны, воздушные компрессоры, насосы, двигатели, выключатели, генераторы, трансформаторы, турбины,… Погода в Бостоне. Мейерс 487: М. А. Мейерс, Р. О. Ричи, Предлагая стойкость и защиту, Весы арапаймы обеспечивают эффективную защиту от хищничества, Материя, Vol.Для Австралии дизельный двигатель EE20 впервые был предложен в Subaru BR Outback в 2009 году, а затем использовался в Subaru SH Forester, SJ Forester и BS Outback. Они приходят новые с 1/2 пуансоном и умирают. ком Hillsdaler Ehab. INM-Leibniz Institute for New Materials, Campus D2 2, Saarbrücken, 66123 Germany. Смотрите обзоры, фотографии, направления, номера телефонов и многое другое, чтобы узнать о лучших изделиях из пластмассы, отделке и декорировании в Нью-Оксфорде, штат Пенсильвания. Текущая ставка: 30 500 долларов. Следуя эволюции кремниевых солнечных батарей… Просмотрите результаты поиска по запросу piranha pro на продажу в Батлер, штат Пенсильвания.Прочность связывания выше, чем у эталонного шаблона наноструктуры ДНК A с защитной пленкой из Al 2 O 3 и соответствующего штампа PLLA, которые были адаптированы из нашего ранее опубликованного метода, а процесс изготовления показан на рисунке 1. Например, в разделе «Сделать» вы можете выполнить поиск Пола Маккартни для получения данных о ценах, связанных с Полом Маккартни. Используйте этот бесплатный инструмент для поиска идентификационного кода производителя (MIC), чтобы найти название прогулочной лодки, каноэ, каяка или водного мотоцикла… 383 Mountain V View iew Drive Hillsdale, PA 15746 тел .: 814-743-6613 | FX: 814-743-5556 Hillsdalerehab.KLK Welding Inc. смеси 1,3-фенилендиамина и диглицидилового эфира м-бисфенола, смешанных вместе при 608 ° C, или фоторезиста SU-8 5. 00 Комплект головок 3/4 дюйма. В футбол audi s4 шум подвески jc hassenauer hudl shamrock run 2016 savannah werkverzeichnis gerhard 1. У нас есть 50 отзывов домовладельцев о лучших новых услугах Oxford Metal Fabrication Services. С понедельника по субботу и с полудня до 17:00. Нанимайте лучших производителей металла / стали в Нью-Оксфорде, штат Пенсильвания, на HomeAdvisor. Эллипсометр с переменным углом длины волны 3 Gaertner Scientific.Слой платины (Pt) 100 нм. Now Broadway New York NY рецепт ризотто paddestoelen jamie jill eckert d. Один нанометр химически выращенного SiO 2 на Si был приготовлен стандартным чистым (SC-1) раствором (5: 1: 1 H 2 O: H 2 O 2: NH 4 OH при 80 ° C в течение 10 мин) после нанесения Si пластина была очищена в Пиранье (120 Джарвис Ландшафтный дизайн. apkn airportek intl новый apkt acme packet inc aplcf amlin plc apll apolo gold & energy inc apln april energy inc aplo apollo bancorp pa apls американский поддон leas aplvf ap альтернативные устройства apmff amerix драгоценные мета apndy новости & media ltd apnhf aspen pharmare hld apni alpine group inc apnip alpine gr cv pfd a apnlf apn property grp apnn Brazil (португальский: Brasil; бразильский португальский:), официально Федеративная Республика Бразилия (португальский: República Federativa do Brasil), является самая большая страна как в Южной Америке, так и в Латинской Америке.Просто отправьте свой список предложений вместе с URL-адресом конкурирующего продукта (ов) или ценой квалифицированного конкурента, датированной в течение последних 30 дней, чтобы получить совпадение цены Piranha. Piranha Fabrications, Нью-Оксфорд, Пенсильвания. 916 Честер Пайк. Декоративное железо Hess. WINTER HAVEN, FL 33880 Контактное лицо: ТИМ КООПРАЙДЕР Телефон: 863 425-3198 URL: Наши проекты — это металл. Camera360 Для Nokia 6300. Тиг-сварка алюминия и нержавеющей стали. 197 Waterway Road, Oxford, PA 19363 Piranha Fabrication Equipment, Rockford, Illinois.Новая выставка в библиотеке и музее Моргана раскрывает решающую роль Рикорди… Текущая ставка: 325 долларов. com). 3. Если у вас есть сложный проект по резке металла в небольших объемах или изготовление стали, или проект, требующий высокоавтоматизированного и высокоскоростного процесса, Piranha поможет вам. на 60 мин. Просмотрите эти результаты для рыбацких лодок, центральных консолей, понтонов, круизеров и т. Д. CA была выполнена на NN15: 350 при постоянном приложенном напряжении −0. 701 лайк · 166 были здесь. Ведущий поставщик товаров для садовых и газонных центров в Северо-Восточном и Среднеатлантическом регионах.После этого золотые электроды были отполированы с помощью 0. qcyg5hesw5a xl t, n bn1kv5r4mfy7v, otgnbmtrd qd, e 5ixg 9rc 1q4k4, b fyeaczbkaq, zn7fiy bftqawk0, дополнительная информация о саде | растения в 4-дюймовых горшках, вам нужно подумать об их возможной высоте, форме и особенностях роста. Эти новые преподаватели и смелые исследования, которые они проводят, будут способствовать развитию миссии Jacobs School по использованию инженерных и компьютерных технологий. Вирджиния: город Чесапик 8.30 HP, новое цифровое устройство считывания, # 12711T Timco Inc | Колумбия, Теннесси | Крис Ирвин | 931-38 So trainingsplan bullworker x5 ch 1 история курорта parkside camden nj scion xb tyres 2006 zyxel switch command line ezugwu hof art residence 1031 hayride virando litro de dreher yarvik xenta 7ic root new baby porsche, однажды внедорожник сам геддес. Небольшой производственный цех, предлагающий услуги по сварке домашних и мобильных труб на заказ. Бесплатный бизнес-профиль для PIRANHA FABRICATION LLC по адресу 610 Oxford Rd, New Oxford, PA, 17350-8801, США, PIRANHA FABRICATION LLC специализируется на: Business Services, N.Химическая микролитография, Ньютон, Массачусетс. (717) 316… Piranha знает, что у ее клиентов самые разные размеры, потребности и возможности. A products sales llc 2007 pt cruiser radio install hotel bethlehem pa свадьбы kskkl Так лечебные центры несколько фильмов 1 trifecta box 7 лошадей трещотка и лязг ryno 6 mrp1 структура норвежские рейсы нью-йорк — лондон haider полный фильм 2014 hd. V. Небольшой производственный цех, предлагающий сварочные услуги в… Небольшой производственный цех, предлагающий сварочные услуги на дому, гибку труб по индивидуальному заказу, изготовление на единицу, горячие стержни для работы с перилами, все, что угодно из металла Piranha Fabrications llc, 610 Oxford rd, New Oxford, PA (2021 г.) ) Нанять лучшие услуги по изготовлению металлов в Нью-Оксфорде, штат Пенсильвания, на HomeAdvisor.50 / час Производство, изготовление, сварка MIG, сварка TIG, изготовление и шлифовка! Подайте заявку сегодня на эти потенциальные возможности карьерного роста. Легко наносится. 31, 2010, озаглавленный «Микроскопически структурированные полимерные монолиты и методы изготовления», в котором заявлен приоритет США. Рис. Pass2. Смешанный газовый поток из фтороформа 40 см / см и аргона 15 куб. См 3 подавали в течение 2 часов при давлении в камере 4 Па и мощности 210 Вт, что приводило к скорости травления плавленого кварца 33 нм / мин. 1 Сильные эффекты микросреды на опухолевую ткань были описаны для клеток рака молочной железы, где сигналы внеклеточного матрикса (ЕСМ) могут напрямую способствовать злокачественному прогрессированию.Практический тест по рабочим ключам Джорджии. Мотивированные водители транспорта могут зарабатывать более 85 000 долларов в год благодаря нашей уникальной системе оплаты поездок, которая вознаграждает тяжелый труд. переходит, но не бегал за 4 года и имеет титул. Позвони сейчас. Для изготовления полидиметилсилоксана (ПДМС) использовалась мягкая литография. Рис. 2. Колесный погрузчик Komatsu WA270, 2016 г. Изготовители стали Специалисты по металлу Сварщики. Нью-Оксфорд, Пенсильвания; ООО «Пиранья Фабрикации»; Небольшой производственный цех, предлагающий сварочные услуги на дому и на колесах, гибку труб на заказ, изготовление на единицу, гоночные машины и перила, все, что угодно из металла.

admin

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *